SecReT4
Protein ID: 197105819
T4SS name [ID]VirB [23]
Gene symbolvirD4
Locus tagPHZ_c2357
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]2669091..2670875 [+]
Producttype IV secretory pathway, VirD4 component
Component typeVirD4
UniProt IDB4RFV4
KEGG IDpzu:PHZ_c2357
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.6e-96, Aligned region: 70..515
TraG-D_C [PF12696], Evalue: 1.4e-29, Aligned region: 361..480
TrwB_AAD_bind [PF10412], Evalue: 9.1e-24, Aligned region: 275..494
Protein Sequence: 594 a.a.     [Download]
>gi|197105819|ref|YP_002131196.1| type IV secretory pathway, VirD4 component [Phenylobacterium zucineum HLK1]
MAALVALAGLGRLSPDIDPAAIPGWFWYFRGDPEVRRWARIGLLISTGLGALVTVGALRGLRRPLHGAAR
WASEIDLRRAGLRARDGVLLGRRNGAPLAFGGSEHVMLYAPTRTGKGVGVVVPNLLNWPHSVVCLDVKGE
NWAASAGFRAAQGQKVYFFDPLEAEGRTARYNPLGHIDRRDPTAVLDELQKLAVMLFPAPPGADPFWAEA
ARTGFIGVGAYVAATPELPFSVGAIYTELTRGDPRARFPREMAARRAAGRPFHWGCEQALADFCASSENT
FASVRQTLTSRLNLWLSPRVCAATQTSDFDLRTFRDEPQSLYLATSPDNLTRVAPLYNLLFQQLIDLNTR
EPPTSTFHTVPVLVLLDEFARLGHAPVLAHAFAYVAGYGLRLLPVLQSPAQLRAEYGRDLAEEIIANCGV
EIAFAPKELKVAQELSERLGYTTVSSPSRSRPSGLARGHRSVSESEQRRALMLPQELLQLASDALIVLRA
GVPPVRGRKIVYFRERVFIRRLRSPPVVPKLSVPIAMSRDPPVASDAVDDPLTLDAVTRELAARNLEPPP
PPAASEDDVADWIDRFIDAAVPPATSDREARSER
 
Nucleotide Sequence: 1785 bp     [Download]
>gi|197103466|ref|NC_011144.1|:2669091-2670875 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGGCTGCGCTTGTCGCGCTGGCTGGCCTTGGCCGCCTCAGCCCCGACATCGATCCTGCCGCTATTCCGG
GCTGGTTCTGGTACTTCCGGGGCGATCCTGAGGTCCGTCGCTGGGCGAGGATCGGGCTGCTTATTTCGAC
AGGCCTCGGGGCCCTCGTCACCGTCGGCGCCCTCCGCGGCCTGCGTCGCCCGCTGCATGGCGCGGCGCGC
TGGGCCAGCGAAATCGACCTGCGGCGCGCCGGGCTGCGGGCCAGGGATGGCGTTCTGCTTGGACGCCGTA
ACGGTGCGCCACTCGCCTTTGGCGGGTCGGAGCACGTGATGCTCTACGCCCCGACCCGCACCGGCAAAGG
GGTCGGCGTGGTGGTCCCCAACCTTCTGAACTGGCCCCATTCCGTCGTGTGCCTGGACGTCAAAGGCGAG
AACTGGGCCGCAAGCGCGGGCTTCAGGGCCGCGCAGGGTCAGAAGGTCTACTTCTTTGATCCCCTGGAGG
CGGAGGGTCGCACGGCCCGCTACAACCCGCTGGGCCATATCGACCGCCGGGATCCCACAGCCGTCCTGGA
CGAACTGCAGAAGCTCGCCGTCATGCTATTCCCGGCGCCGCCCGGCGCCGACCCGTTCTGGGCGGAAGCC
GCCCGCACCGGGTTCATCGGCGTGGGCGCCTACGTCGCTGCGACGCCTGAGCTGCCGTTCTCTGTTGGCG
CCATCTACACGGAACTGACGCGCGGCGATCCTCGCGCCCGCTTCCCGCGCGAAATGGCGGCCCGGCGGGC
TGCAGGCCGGCCGTTTCACTGGGGGTGTGAGCAGGCGCTCGCCGATTTCTGCGCCAGCTCAGAGAACACC
TTCGCCTCCGTCCGCCAGACGCTCACTTCGCGATTGAACCTCTGGCTCAGTCCACGGGTCTGCGCGGCGA
CGCAGACCAGCGACTTCGACCTGCGAACTTTCAGGGATGAGCCCCAGTCCCTGTACCTGGCGACCAGTCC
CGACAACCTCACCCGGGTCGCTCCCCTCTACAATCTGCTCTTTCAGCAGCTCATCGACCTGAACACCCGC
GAGCCGCCCACCTCCACATTCCACACCGTCCCGGTGCTCGTGCTGCTCGACGAGTTTGCCCGCCTTGGGC
ACGCGCCGGTCCTGGCTCACGCTTTTGCCTATGTCGCGGGTTATGGACTTCGACTCCTTCCGGTCCTGCA
GAGCCCGGCTCAGTTGCGCGCTGAGTACGGACGCGATCTCGCCGAGGAGATCATCGCCAACTGCGGCGTC
GAGATCGCCTTCGCGCCCAAGGAGCTGAAGGTCGCGCAGGAGCTCTCGGAGCGCCTGGGCTACACGACCG
TCTCGAGCCCCTCGCGCAGCCGCCCGAGCGGCCTCGCCCGAGGCCACCGCAGCGTCAGCGAGTCTGAACA
GCGTCGCGCTCTGATGCTCCCTCAGGAGCTTCTGCAGCTGGCTTCGGACGCGCTCATTGTCCTGCGCGCC
GGGGTACCGCCCGTGCGGGGCCGCAAGATCGTCTATTTCCGCGAGCGGGTCTTCATACGCCGTCTGCGCT
CCCCTCCTGTCGTCCCGAAACTCAGCGTCCCCATCGCTATGTCCCGAGACCCGCCAGTCGCGTCGGATGC
CGTAGATGATCCCCTGACCCTGGACGCCGTGACGCGCGAACTCGCCGCTCGCAACCTCGAACCGCCGCCG
CCCCCTGCCGCCAGCGAAGATGATGTCGCCGACTGGATCGACCGCTTCATCGACGCGGCCGTCCCGCCGG
CCACGAGCGATCGGGAGGCGCGAAGTGAGCGATGA
 Primer design