SecReT4
Protein ID: 197247306
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0026
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]15286..16074 [-]
Productconjugal transfer outer membrane protein
Component typeVirB9
UniProt IDB5EWG3
KEGG IDsea:SeAg_A0026
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.9e-55, Aligned region: 30..237
Protein Sequence: 262 a.a.     [Download]
>gi|197247306|ref|YP_002144952.1| conjugal transfer outer membrane protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MKKILLAGCIAATLPGVANALNVPQPTSYDARIQEATYNPDDAVLVRVKAGTSTLIKLQDGEFITDDQAG
MGFGDPDAWDVSVRGNNIFIRPIAEQPDTNVTLVSNKRTYVFFLQSVKGNPSWMVRFKYPKKYSAANATV
FKRPPCQSNGAYNANWNYQLQGKESFAPYEVWDDGRFTCFKFNPSSDLPMIYRVAGDGEEMLVNGNPDSE
NNNIIVVQETNPEFVIRLGKKVVAVRSDTIKAMPSNRSGTTNGMTREIKSDE
 
Nucleotide Sequence: 789 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c16074-15286 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGAAAAAGATTCTGTTAGCTGGGTGCATAGCGGCAACTTTACCAGGCGTTGCGAACGCCTTGAATGTGC
CGCAGCCGACGAGCTATGACGCTCGCATTCAGGAAGCTACTTATAATCCTGATGATGCTGTTCTCGTTAG
GGTTAAAGCCGGAACATCAACACTCATTAAGTTACAGGATGGTGAATTTATAACTGATGATCAGGCAGGG
ATGGGGTTTGGTGATCCTGATGCTTGGGATGTTTCTGTACGAGGGAATAATATTTTTATCAGGCCAATCG
CTGAACAACCTGATACGAATGTTACGTTAGTATCAAATAAGCGAACTTATGTTTTCTTTTTACAGTCTGT
AAAGGGTAATCCTTCATGGATGGTTAGATTTAAATATCCTAAAAAATACAGTGCAGCAAACGCGACAGTA
TTTAAAAGGCCGCCTTGTCAGTCTAATGGCGCTTACAATGCGAACTGGAATTATCAGTTGCAGGGTAAAG
AGTCTTTCGCACCGTATGAAGTATGGGATGATGGGCGCTTTACATGCTTTAAATTTAATCCTTCAAGCGA
TCTTCCAATGATTTACCGTGTTGCTGGCGATGGTGAAGAAATGCTAGTGAATGGGAATCCTGATAGCGAG
AATAATAATATTATTGTTGTACAGGAAACTAACCCTGAGTTTGTAATTCGTCTCGGTAAGAAAGTTGTAG
CGGTTCGGTCAGATACGATTAAGGCAATGCCGTCTAATCGTAGTGGTACTACCAATGGCATGACTAGGGA
GATTAAATCTGATGAATGA
 Primer design