SecReT4
Protein ID: 197247309
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0032
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]20726..21043 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDB5EWG9
KEGG IDsea:SeAg_A0032
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.3e-05, Aligned region: 4..96
Protein Sequence: 105 a.a.     [Download]
>gi|197247309|ref|YP_002144958.1| hypothetical protein SeAg_A0032 [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MQKTKNFLLKVKVLAFSFFASVMASTPMSAFAAGGISGAEGGISTAQTAIYSLLGAGAAVYLLIKGFMLK
INKIGWNDLFMAMVTCAVVAGLPALAVWFWDLGGN
 
Nucleotide Sequence: 318 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c21043-20726 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGCAAAAAACTAAAAACTTTCTGTTAAAGGTAAAGGTTCTGGCTTTTTCTTTCTTCGCTAGTGTCATGG
CATCTACACCTATGAGCGCGTTTGCTGCGGGTGGTATTAGTGGTGCGGAAGGTGGGATCTCAACCGCGCA
GACCGCCATTTACTCTCTGCTTGGTGCAGGTGCGGCGGTATATCTTTTGATTAAAGGCTTTATGCTTAAA
ATCAATAAAATTGGCTGGAACGATTTGTTTATGGCAATGGTTACTTGTGCTGTCGTTGCGGGTCTGCCAG
CGCTTGCTGTTTGGTTCTGGGATCTCGGCGGCAACTAA
 Primer design