SecReT4
Protein ID: 197247313
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0029
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]17112..17765 [-]
Productputative conjugal transfer protein
Component typeVirB5
UniProt IDB5EWG6
KEGG IDsea:SeAg_A0029
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.4e-27, Aligned region: 21..204
FTA4 [PF13093], Evalue: 2.6e-05, Aligned region: 36..185
Protein Sequence: 217 a.a.     [Download]
>gi|197247313|ref|YP_002144955.1| putative conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MLLSALTVNSILVSPPTFATGIPVFDAASATNMLQQLQAAKQQYDQLVEQYKQAKSLHDQTIAEGKRLYE
GVTNFDVNDLLDDPTLSSYLPNKRTADSLLDAADNIGELREKYKLTSSDSEVQKAYDSMLTELNNMQTAY
NTAVKRSDHISNLSKKLEQAATPQEKADYQNAINTESNNLLNEKTKLDLAKANFDANFKIAQASRRAEFK
EEFSVDK
 
Nucleotide Sequence: 654 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c17765-17112 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGCTGTTAAGTGCCTTAACAGTGAATAGCATACTGGTTTCACCGCCAACATTTGCTACGGGTATTCCTG
TATTTGATGCGGCAAGTGCAACTAATATGCTTCAACAATTACAGGCAGCGAAACAGCAGTATGATCAGCT
TGTCGAGCAGTATAAGCAAGCTAAAAGCTTGCATGACCAGACGATAGCGGAAGGTAAGCGCCTATATGAA
GGGGTGACTAACTTTGATGTAAACGACTTATTGGACGACCCAACATTAAGTAGCTATCTTCCAAATAAAC
GAACGGCTGATTCTTTATTAGATGCTGCGGATAATATTGGTGAGTTGAGGGAGAAGTACAAACTCACTTC
TTCTGATTCCGAAGTTCAGAAAGCATATGATAGTATGTTGACTGAATTAAATAATATGCAAACTGCGTAT
AATACGGCTGTTAAACGCAGTGATCATATTTCCAATCTTTCCAAAAAGCTTGAGCAAGCCGCTACTCCGC
AAGAAAAAGCGGATTATCAAAACGCAATTAACACTGAGTCAAATAATCTTCTCAATGAGAAAACTAAGCT
TGACTTAGCGAAAGCTAACTTTGATGCAAACTTTAAAATTGCTCAAGCATCACGCCGCGCTGAGTTTAAA
GAAGAATTTAGCGTTGATAAATAA
 Primer design