SecReT4
Protein ID: 197247317
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0033
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]21057..21734 [-]
Productconjugal transfer protein
Component typeVirB1
UniProt IDB5EWH0
KEGG IDsea:SeAg_A0033
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.5e-12, Aligned region: 14..149
Protein Sequence: 225 a.a.     [Download]
>gi|197247317|ref|YP_002144959.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MVLAAPVLASLLMQCGGNVDPTTLQTIISVESDGNPYVVANVTKNTSHYFKSKNEAVHFVNELAKVGDKY
SVGLGQIYVGNFKSYGLTNETAFDFCKNVTVASKIFEECYYRAIDSGEYPDEQQALRAAASCYYSNNFTR
GFKKEKNGKSYIDLANNAVNKIYSVPAMKPVGAGDSLTPVNNNLRRGIVYQQPEGDQPEMVESAVNVEGN
KPARAAWDVFNDFAK
 
Nucleotide Sequence: 678 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c21734-21057 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGGTTCTTGCTGCTCCTGTATTAGCAAGTCTGCTAATGCAATGCGGTGGGAATGTTGATCCGACTACAC
TACAAACAATTATTTCAGTGGAGTCAGACGGCAATCCTTACGTTGTGGCTAATGTCACTAAAAACACTTC
GCACTACTTTAAATCCAAAAATGAAGCAGTCCATTTTGTTAATGAGCTTGCTAAAGTAGGTGATAAATAC
TCTGTCGGTCTTGGACAGATTTATGTAGGTAACTTTAAAAGTTATGGGTTGACTAATGAAACGGCCTTTG
ACTTTTGTAAGAACGTTACGGTGGCCTCAAAAATATTTGAGGAATGTTATTACCGTGCGATTGATAGCGG
GGAATATCCTGATGAACAGCAAGCATTGAGGGCTGCGGCATCGTGCTACTATTCAAATAATTTTACGAGG
GGGTTCAAAAAGGAGAAGAACGGGAAAAGCTATATTGATCTGGCTAATAACGCTGTGAATAAAATCTATT
CTGTTCCGGCTATGAAACCAGTGGGGGCAGGGGATAGCCTAACGCCAGTTAACAATAATCTACGGCGCGG
CATTGTTTACCAGCAACCCGAAGGGGATCAGCCTGAAATGGTTGAAAGTGCAGTTAATGTAGAAGGGAAC
AAACCAGCGCGGGCTGCTTGGGATGTTTTCAATGATTTCGCTAAATAA
 Primer design