SecReT4
Protein ID: 197247321
T4SS name [ID]VirB [465]
Gene symbolvirB
Locus tagSeAg_A0024
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]12929..13990 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB5EWG1
KEGG IDsea:SeAg_A0024
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.8e-54, Aligned region: 20..323
Protein Sequence: 353 a.a.     [Download]
>gi|197247321|ref|YP_002144950.1| P-type DNA transfer ATPase VirB11 [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MNESYGNFNVIRNQLSKTGITEILGYDGLTEVAINQPGRIWFERGNGWESQVNEDCNYSNLEMLAQSLSV
KSHTGGIDQDYNASKPIHSVTLPDGERGQIILPPAAEDGTISFTIRKPSKSRFDLNSYINSGRLSDFEIC
GRAYVKEKALTGEQLELLGFLKDKDMDRFFKKSVQMRLNHVMVGATGSGKTTFMKAIADLFPANRRYITI
EDTHELDLPNHPNHVHLFFKREGIGATAKDLIEAGMRMKPDHIFLTELRGDEAWNYLGMLNTGHNGSLTS
THADDNPAAVYSRLSSLIKESKVGTTLDYGLITNTVASTIDIISFWKGSYMTKIYYNPEEKNEAVMRLLG
MVA
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c13990-12929 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGAATGAATCCTATGGAAATTTCAATGTAATCCGTAATCAGTTATCCAAAACAGGAATAACCGAGATTT
TGGGTTATGACGGTTTAACAGAAGTTGCTATAAACCAGCCTGGAAGAATCTGGTTTGAACGTGGCAACGG
TTGGGAGTCGCAAGTTAATGAAGATTGTAATTATTCCAATCTTGAAATGCTTGCTCAATCATTATCCGTC
AAAAGTCATACTGGCGGTATTGATCAGGATTACAATGCTTCGAAACCTATTCACTCTGTAACCTTACCTG
ACGGGGAGAGGGGGCAAATAATCTTACCTCCTGCGGCTGAGGACGGTACAATTTCCTTTACTATTCGCAA
ACCGTCAAAAAGCAGGTTTGATTTAAACAGCTATATTAACAGTGGTCGCCTTTCTGATTTTGAAATTTGT
GGTAGAGCTTACGTAAAAGAAAAGGCTTTGACAGGCGAACAACTCGAACTTCTTGGCTTTCTCAAAGATA
AAGATATGGATCGCTTCTTTAAAAAAAGCGTCCAGATGCGTTTAAATCACGTCATGGTTGGTGCTACGGG
TTCTGGTAAAACTACCTTCATGAAAGCTATAGCAGACCTTTTTCCAGCAAACAGGCGCTATATAACGATT
GAAGATACACATGAACTTGATTTGCCTAACCATCCTAATCATGTTCATTTGTTTTTTAAGCGTGAGGGGA
TCGGCGCTACGGCAAAAGATTTAATTGAAGCGGGTATGCGTATGAAGCCAGATCACATCTTCCTCACTGA
ATTAAGGGGCGATGAAGCCTGGAACTATTTAGGCATGTTGAATACTGGTCATAATGGTAGTCTGACTTCT
ACTCACGCTGACGATAACCCTGCTGCTGTATATAGCCGACTTTCATCACTTATCAAAGAATCTAAGGTAG
GTACAACGCTTGATTATGGTTTGATTACAAATACTGTAGCCAGCACAATAGATATAATCTCCTTCTGGAA
AGGTTCTTATATGACGAAAATCTATTACAATCCAGAAGAAAAAAATGAAGCTGTTATGCGTCTTTTAGGC
ATGGTGGCTTAA
 Primer design