SecReT4
Protein ID: 197247336
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0023
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]10886..12907 [-]
Productconjugal transfer protein
Component typeVirD4
UniProt IDB5EWG0
KEGG IDsea:SeAg_A0023
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-93, Aligned region: 109..207
T4SS-DNA_transf [PF02534], Evalue: 1.5e-93, Aligned region: 242..641
TraG-D_C [PF12696], Evalue: 1.6e-27, Aligned region: 468..589
TrwB_AAD_bind [PF10412], Evalue: 1.6e-16, Aligned region: 384..598
Protein Sequence: 673 a.a.     [Download]
>gi|197247336|ref|YP_002144949.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MQLRQNLKKSDIISTIIFAILMLGIGGAIGAYGGGYVFLLISKVDTNLLSYDTLMNAWPLWEYKKLHAAI
SLGTIVFAAAIIVPLAAIIIGAFFEFPEPDVHGNAKLITDEEIKESGLLDADEEYPEILIGKVAKGRHKG
KYLKFAGQQFLGLGAPTRSGKGVGFVIPNLLNYRDSVCVLDIKAENYIFTAGYRKKMGQEVFVFAPDGYR
FSEEEFEEFKFSDYYLNLSPEEQQAFNEKFRNTEHVLSHRWNPLDYISRSKSRRVGEIKDLATILFPDDG
GDNAIWNSMAEAVFESYILYMLDMEETINKINAEIEENRKNGTDDDRELMKPYPVSMAQLYSLTGVPDMA
EWMNDEILYWKDKGYPLSKGCVEGFNRFISVDPKTRGNIMQNFNKPLKIFEAESCRLATSASDFDFNDLR
RKRMSVYIVLSPTGMEKYKQLINLFFSQLVRVNTQTLPEHDKTLKYQCLLVLDEFTSMGRVGIIEKSIAF
TAGYNIRYMIIYQNDEQLESDDAYGKSGAFTLRKNLAVEVVYPPKDVDSTAERISKTFGKKTVKVKTNSR
TSNGGKISNGTNEQYVGRDLYMPQEIVELGSQKYVMQKINKGKRTKVAVNEVIIMEQVKPFVAHKIVYFD
EPVFMERRKVATDNVPDVPILNDIEHYEIPRDKRRDIPSIASA
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c12907-10886 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGCAATTAAGGCAGAATCTTAAAAAGTCCGATATTATATCAACTATAATATTCGCTATCTTAATGTTAG
GCATTGGCGGCGCAATCGGGGCGTATGGAGGCGGTTATGTTTTTCTGCTTATATCGAAAGTAGATACTAA
TCTTCTATCATACGATACCTTAATGAATGCGTGGCCTTTATGGGAGTATAAAAAGTTACATGCCGCAATA
TCATTAGGTACAATTGTATTTGCAGCGGCAATTATAGTTCCTCTGGCTGCTATCATTATTGGTGCTTTCT
TTGAGTTTCCTGAGCCGGATGTACATGGAAATGCAAAATTAATAACTGATGAAGAAATCAAAGAAAGTGG
TTTGCTTGATGCTGATGAAGAATATCCTGAGATTCTGATTGGTAAAGTTGCAAAAGGTAGACACAAGGGT
AAATACCTTAAGTTTGCAGGACAACAGTTTTTAGGGTTAGGCGCTCCAACCCGAAGCGGTAAAGGGGTAG
GTTTTGTTATCCCTAATCTGCTCAATTATCGTGATTCTGTTTGTGTTCTCGATATTAAAGCTGAGAACTA
TATATTTACGGCGGGGTATCGTAAAAAAATGGGGCAGGAAGTTTTTGTTTTTGCCCCTGATGGGTATCGT
TTTTCCGAAGAAGAATTTGAGGAATTTAAATTTAGTGATTACTACCTGAATCTGTCACCAGAAGAACAGC
AAGCTTTTAATGAAAAGTTCCGCAATACTGAGCATGTTTTATCACACCGCTGGAACCCGTTGGACTACAT
AAGCCGTTCAAAATCGCGTCGGGTTGGAGAAATAAAAGATTTGGCAACAATTCTTTTTCCAGATGATGGG
GGTGATAATGCTATCTGGAACAGTATGGCAGAAGCAGTATTTGAATCTTATATTCTGTACATGCTGGATA
TGGAAGAAACGATAAATAAGATCAACGCAGAGATTGAAGAAAACAGGAAAAACGGTACTGATGATGACAG
GGAGCTTATGAAGCCCTATCCGGTTTCTATGGCGCAACTGTATTCCCTTACTGGCGTACCAGATATGGCT
GAGTGGATGAATGATGAAATCCTTTACTGGAAAGATAAAGGGTATCCACTTAGTAAAGGTTGTGTTGAAG
GTTTCAACAGATTTATATCCGTAGATCCAAAAACGCGCGGTAATATCATGCAGAACTTCAATAAACCTCT
TAAGATATTTGAGGCTGAGTCTTGCCGACTCGCTACTTCTGCTTCTGACTTTGACTTTAATGATTTACGG
CGTAAAAGAATGTCAGTATATATTGTGCTTTCTCCAACAGGCATGGAAAAGTATAAGCAGTTAATTAATT
TGTTCTTTAGTCAGTTGGTGAGAGTTAACACACAAACTCTGCCAGAGCATGATAAAACATTAAAATATCA
ATGCCTCCTAGTGCTGGATGAATTTACGTCTATGGGGCGTGTGGGTATTATAGAGAAATCTATAGCGTTC
ACGGCAGGTTATAATATTCGTTATATGATTATCTATCAGAATGATGAACAGTTAGAATCTGATGATGCTT
ACGGCAAATCAGGGGCTTTCACGCTGAGAAAGAACCTTGCTGTAGAAGTTGTTTATCCTCCTAAAGATGT
TGATTCTACCGCTGAGCGTATTAGTAAAACATTCGGCAAGAAAACCGTTAAAGTTAAAACTAACTCCAGA
ACAAGTAACGGCGGTAAAATCAGTAACGGCACGAACGAGCAATACGTAGGCCGTGACCTTTATATGCCGC
AAGAGATTGTAGAGCTAGGGTCACAAAAATATGTGATGCAAAAGATTAATAAGGGGAAAAGAACGAAAGT
CGCCGTTAATGAAGTCATAATCATGGAACAGGTTAAGCCGTTTGTTGCTCATAAGATTGTGTACTTTGAT
GAACCGGTATTCATGGAAAGGCGTAAGGTTGCTACTGACAACGTTCCAGATGTACCTATCCTGAATGATA
TTGAACATTATGAAATTCCACGCGATAAGCGGCGTGATATTCCGTCTATCGCCAGTGCTTAA
 Primer design