SecReT4
Protein ID: 197247337
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0025
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]14067..15293 [-]
Productconjugal transfer protein
Component typeVirB10
UniProt IDB5EWG2
KEGG IDsea:SeAg_A0025
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.1e-53, Aligned region: 224..401
Protein Sequence: 408 a.a.     [Download]
>gi|197247337|ref|YP_002144951.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MNDNQKDEIGAIPSIDDDRATVDLQGQRGKKASKGYLKDILIFGGAIVLILAVAGAFVWRAFHKVDTEEA
GKPVDPTLEKSVGSDTGNRGVDKLMNTIAERKAAEEKAAEEERKAAEAKRLAEEKAKQDALMAQLQAQGK
LGNGSANNNTSRAGGNGGNNDAPPTPQERKLQGKGLVYAGSEGKDTANGGAASQSAGGGLNKALEGGTYA
NGQASILKDRSLLLGMGTVLPCVLKTKIVTTYQGLPICQLTKNIYSNDGNTLLLEAGTKFFGEQQNALVQ
GQARVFVNWTTAETPKGIRVRIDALGVDGLGAAGIPAWVDLHFWQRFGNAIMLSFIDDALATAANKISDN
NNNNSIKVDNTEDAASNMASIALENSINIPPTAYINQGELISIIVPRDTYFNNVYELH
 
Nucleotide Sequence: 1227 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c15293-14067 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGAATGATAATCAGAAAGATGAAATCGGTGCTATCCCTTCTATTGATGATGATCGCGCAACGGTAGACT
TACAAGGCCAGCGCGGTAAGAAAGCCTCAAAAGGTTATCTGAAAGACATTCTCATATTTGGGGGGGCTAT
TGTTCTAATCCTCGCGGTGGCAGGTGCCTTTGTCTGGAGAGCTTTCCATAAAGTTGATACAGAAGAAGCG
GGTAAGCCGGTTGATCCGACACTTGAAAAAAGTGTTGGTAGCGATACTGGGAATAGGGGCGTGGATAAGC
TGATGAATACCATTGCTGAGCGTAAAGCGGCAGAAGAAAAAGCCGCAGAAGAAGAACGTAAAGCAGCAGA
AGCAAAACGCCTAGCAGAAGAAAAAGCTAAACAAGATGCGCTAATGGCTCAATTACAAGCCCAGGGTAAA
TTAGGTAACGGCAGCGCAAACAACAACACTTCACGAGCTGGCGGGAACGGTGGTAATAACGATGCCCCGC
CAACGCCGCAGGAACGAAAGCTACAGGGTAAAGGCTTGGTTTACGCAGGTAGCGAGGGCAAAGATACTGC
TAATGGTGGTGCGGCCTCACAAAGCGCGGGAGGGGGCTTAAATAAGGCGCTGGAAGGTGGTACTTACGCC
AATGGTCAGGCTTCCATTCTGAAAGACCGTAGTTTGCTGTTAGGCATGGGTACAGTCTTACCCTGTGTGC
TGAAAACAAAGATCGTTACCACTTATCAGGGGTTGCCAATCTGCCAGTTAACCAAAAACATCTACTCAAA
CGATGGAAATACATTATTGCTTGAGGCGGGTACTAAATTCTTTGGTGAACAGCAGAACGCCCTTGTTCAA
GGTCAGGCGCGAGTATTCGTAAACTGGACAACAGCCGAAACACCTAAAGGTATTCGCGTTCGTATTGATG
CTCTTGGTGTTGATGGTCTTGGGGCGGCGGGTATTCCGGCATGGGTTGATTTGCACTTCTGGCAGCGTTT
TGGTAATGCAATTATGCTTAGCTTCATTGATGATGCGCTGGCAACGGCAGCAAACAAAATCAGTGATAAT
AACAATAATAACAGCATTAAAGTTGATAATACCGAAGATGCCGCCAGTAACATGGCAAGTATCGCGCTTG
AAAACTCAATTAATATTCCACCTACGGCATATATTAATCAAGGTGAATTGATTTCAATCATCGTACCGCG
TGATACTTATTTCAATAATGTTTACGAACTCCATTGA
 Primer design