SecReT4
Protein ID: 197247349
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0027
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]16096..16887 [-]
Productconjugal transfer protein
Component typeVirB8
UniProt IDB5EWG4
KEGG IDsea:SeAg_A0027
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7e-48, Aligned region: 49..260
Protein Sequence: 263 a.a.     [Download]
>gi|197247349|ref|YP_002144953.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MFKRNPKKLNEQERAEIYDKNKKMAELTAPERKQLDADKSVHLSAIAGFQRDRVSEQRRMMWIGFGFGGI
GVVAAGAMAVALAFLTPLKEVKPYIAEVDQVTGQVNIVSAVGDDKIKLTYQSLIDASNLANFVVERESYD
WNSIQNSLDQVKLRSTPSVYESMRRFIVESPNSPLVLLAKDKVMKVGITSKPIVDSNKGVGTVRFYKAVT
DGAGKPIPGYPITHWQATITFDYEHKLRTDDDYINNPLGFNVTSYRVDQESQK
 
Nucleotide Sequence: 792 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c16887-16096 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGTTTAAACGCAATCCAAAAAAGCTCAACGAACAAGAACGCGCCGAAATTTACGATAAAAATAAAAAAA
TGGCCGAACTAACCGCTCCAGAAAGAAAGCAACTAGACGCTGATAAAAGCGTACATTTAAGCGCTATTGC
AGGGTTTCAGCGCGATAGAGTTTCAGAACAGCGACGTATGATGTGGATTGGTTTTGGCTTTGGTGGAATC
GGTGTCGTTGCGGCGGGTGCAATGGCTGTTGCTCTTGCTTTTCTAACACCTTTGAAAGAGGTTAAACCAT
ATATCGCAGAAGTAGATCAGGTTACAGGTCAGGTAAATATCGTTTCAGCAGTAGGCGACGATAAAATCAA
ACTTACTTATCAAAGCCTGATTGATGCTTCAAACCTCGCTAACTTTGTTGTAGAGCGTGAGTCTTATGAC
TGGAACTCAATTCAAAACAGTCTTGACCAGGTTAAACTACGTTCTACACCTAGCGTTTATGAGTCAATGA
GGCGCTTCATAGTTGAAAGCCCTAACTCACCGCTTGTTTTGTTGGCTAAAGATAAAGTAATGAAAGTCGG
TATTACTTCTAAGCCGATTGTAGACAGCAACAAAGGCGTTGGAACCGTGCGATTTTATAAAGCGGTTACT
GATGGGGCTGGTAAGCCGATTCCTGGCTATCCGATTACGCACTGGCAAGCCACGATTACTTTTGACTATG
AGCATAAATTAAGAACCGATGATGATTATATTAATAATCCACTTGGTTTTAATGTGACTAGTTATCGTGT
CGATCAAGAATCACAAAAATAA
 Primer design