SecReT4
Protein ID: 197247350
T4SS name [ID]VirB [465]
Gene symbol-
Locus tagSeAg_A0030
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconplasmid unnamed [GenBank: NC_011148] [Browse all T4SS(s) in this replicon]
Location [Strand]17776..20301 [-]
Productconjugal transfer protein
Component typeVirB4
UniProt IDB5EWG7
KEGG IDsea:SeAg_A0030
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5e-20, Aligned region: 427..727
CagE_TrbE_VirB [PF03135], Evalue: 2.6e-18, Aligned region: 166..357
Protein Sequence: 841 a.a.     [Download]
>gi|197247350|ref|YP_002144956.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MSTNKSNARSINKKALEGKIPHYRYPVTDSISMIGDNKLMATVKIAGYPYELADDSELYSNYNLFRTYLV
SIGKDMAGQLGLWTYIDKREILVNDVYKSNNVFIQKFVDKYMERFNTGGRYYESVYYITLIYNYGQSSID
DGIKKLDSVIKMSEKICGPFGLSVLQNDGYMNESANFLSWLINHHDFKVPLVEDPIYKVVGNSERIFGYD
ISLIRNANDAQDKYCVSYTLRSFPAKIKPGALDFILSIPCELTFAQSYIYTRQLTAISIIDGQANKINST
NAAIDEEGTALNSIKNLVQNGEVFLGDYHGVVSVYGKTAKEAYDNAILVESGFSAAGYVLLRATDEQEDV
FISSLPDAKKRPLNTVRSTSTLADQFSLHNFSVGKRTGNPMGDGTAMMPVETLQGGIHYLSTTDSDPAKD
VVGEPESGHGIFLGQTGTGKTTLQASLTSFVERFNPMLFGIDFKQSMRLPMMMLGAQYFVLREGEFTGLN
PFQLDEIKMATDDNGIVDQAFAEQIKERIRQFCYSWVERIGANSEGGLDDGDSAKIVRAVDAVMELPREG
RRFSNVLEMIAASPLRNRLMEFSAYANGGRMGRYAWAVDSPENKFDPLLFDRVAFDSTVILKKQPNGKPH
PAAEILLAVLFFYKDLMKINPRKKGRWTIFSCEEFWMPANFPLTQEQLKQSLKAGRMDYEMCWLISQQPV
DAINCAIFNEINEQTTIRVLLPNPNAKWQHYKEIGITRKEFRKLKSLAKTSRTFLIKKSNTSVFGTMDLH
GFDEFLPVLSGDKYGVQAAEEIIKRIGSNDPNDWIPIFIQENARNHKLRKAEHDDEEEGIEYEDTEYEDA
E
 
Nucleotide Sequence: 2526 bp     [Download]
>gi|197247299|ref|NC_011148.1|:c20301-17776 Salmonella enterica subsp. enterica serovar Agona str. SL483 plasmid unnamed, complete sequence
ATGTCTACGAACAAATCAAACGCGCGAAGCATTAACAAGAAAGCTCTTGAAGGAAAAATTCCCCACTATC
GTTATCCTGTGACTGACTCAATCTCAATGATTGGGGATAACAAGCTAATGGCTACGGTTAAAATAGCGGG
TTATCCATATGAGCTGGCTGATGATTCTGAACTTTATAGTAACTATAATTTGTTTAGAACATACCTGGTC
AGTATTGGTAAAGATATGGCTGGTCAGCTTGGTTTATGGACTTACATAGACAAGCGTGAAATCCTTGTTA
ATGATGTTTATAAATCGAACAATGTTTTTATTCAGAAGTTTGTTGATAAATACATGGAGCGGTTTAATAC
AGGTGGCAGGTACTATGAATCTGTATACTACATCACGCTGATTTATAATTACGGTCAATCTTCAATTGAC
GATGGCATAAAAAAACTTGATTCCGTCATTAAAATGTCGGAAAAAATTTGTGGCCCATTTGGGTTATCGG
TACTGCAAAACGATGGGTATATGAATGAGTCTGCGAATTTCCTTTCATGGCTCATTAACCATCATGATTT
TAAAGTACCACTTGTAGAAGATCCTATCTACAAAGTAGTTGGGAATAGTGAGCGCATTTTTGGTTACGAT
ATAAGCCTTATCCGTAATGCAAATGATGCTCAAGATAAATATTGTGTTTCTTATACCCTTCGTTCATTCC
CTGCAAAGATTAAGCCTGGTGCGCTTGATTTTATTCTATCAATTCCTTGCGAATTAACATTTGCCCAATC
TTATATTTATACTCGTCAGTTAACAGCTATATCGATCATTGACGGGCAAGCGAATAAAATCAATTCCACA
AATGCCGCAATTGATGAAGAAGGTACAGCGCTCAACTCAATTAAAAACCTTGTTCAAAACGGTGAAGTGT
TTCTTGGTGATTATCATGGTGTTGTTTCGGTTTATGGTAAAACCGCTAAAGAGGCTTATGATAATGCAAT
TCTTGTTGAATCAGGCTTTAGCGCTGCGGGATATGTGCTGCTTCGTGCCACGGATGAACAAGAAGATGTT
TTTATAAGTTCACTTCCTGATGCTAAGAAAAGACCGCTCAATACCGTTCGTTCTACTTCTACCCTGGCTG
ACCAGTTCTCTCTACATAATTTCTCGGTAGGTAAGCGTACTGGCAACCCTATGGGGGATGGAACGGCAAT
GATGCCTGTAGAAACGTTACAGGGCGGGATTCATTACCTTTCAACGACTGATAGTGATCCTGCTAAAGAT
GTAGTAGGTGAGCCAGAATCAGGGCACGGTATCTTTTTAGGTCAAACAGGTACAGGTAAAACAACATTGC
AGGCGTCTTTAACATCCTTCGTTGAGCGCTTTAATCCGATGTTATTCGGCATTGACTTTAAGCAGTCGAT
GCGATTACCCATGATGATGTTGGGTGCGCAATACTTCGTTCTGAGGGAAGGTGAGTTTACTGGCCTGAAC
CCTTTCCAGTTAGATGAAATAAAAATGGCAACGGATGATAACGGTATAGTTGATCAAGCCTTTGCCGAAC
AAATTAAGGAGCGTATACGCCAGTTCTGCTACTCCTGGGTAGAACGTATAGGCGCAAATAGTGAGGGAGG
GCTTGATGATGGTGACAGCGCTAAAATCGTCAGGGCTGTAGATGCGGTAATGGAGTTGCCACGAGAAGGA
CGGCGGTTTAGTAACGTGCTTGAAATGATTGCTGCATCGCCTTTACGTAATCGCCTTATGGAGTTTTCCG
CCTACGCGAACGGCGGGAGGATGGGGCGTTATGCCTGGGCGGTTGATAGTCCTGAAAATAAGTTTGATCC
ATTGCTGTTTGATAGAGTGGCGTTCGACAGTACAGTAATCCTGAAAAAACAGCCTAATGGTAAACCTCAC
CCTGCGGCTGAAATTCTTTTAGCGGTTTTATTCTTTTATAAAGATTTAATGAAGATAAACCCGCGCAAGA
AAGGCCGCTGGACAATATTTTCTTGTGAAGAATTCTGGATGCCAGCTAACTTCCCGCTTACTCAAGAGCA
GTTAAAACAATCGCTCAAAGCGGGGCGTATGGATTATGAAATGTGCTGGCTTATCTCTCAACAGCCAGTA
GATGCTATTAACTGCGCTATATTCAATGAGATCAATGAGCAAACGACAATTCGCGTACTGTTACCTAACC
CTAATGCGAAATGGCAGCATTACAAGGAAATCGGGATAACACGAAAGGAATTCAGAAAGCTTAAATCTCT
TGCGAAAACAAGCCGTACCTTCCTAATTAAGAAATCCAATACGAGCGTTTTTGGTACTATGGATTTACAT
GGATTTGATGAATTCCTGCCTGTTTTATCTGGCGATAAATATGGCGTACAAGCTGCTGAGGAAATCATCA
AGCGGATTGGTTCCAACGATCCTAATGACTGGATACCAATCTTTATTCAAGAAAATGCACGTAACCATAA
GTTACGTAAGGCTGAGCATGATGATGAAGAAGAAGGTATTGAATATGAGGATACTGAGTATGAGGATGCT
GAATAA
 Primer design