SecReT4
Protein ID: 197286273
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2427
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2653922..2654470 [+]
Productphage transglycosylase
Component typeOrf169_F
UniProt IDB4EWP4
KEGG IDpmr:PMI2427
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|197286273|ref|YP_002152145.1| phage transglycosylase [Proteus mirabilis HI4320]
MKTIKAKTIALAIAMSASTSVYAFPGYQWEKAAQSVGIDPVMLYAVALAESASHRGLNMTSPWPYAIRNG
SNATYAKSQTEAEQLLNQALQESEKYQLDIGLMQINLHWHGHRVSSAAELLDPITNLTVGSSILAEAIKS
SPNDLELGIGRYHSWNEERARWYGQRVLSIYRNILHELEVRQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|197283915|ref|NC_010554.1|:2653922-2654470 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAACGATTAAAGCAAAAACCATTGCACTAGCGATAGCCATGTCCGCAAGCACTTCAGTCTATGCTT
TTCCGGGCTATCAGTGGGAAAAAGCAGCACAAAGCGTTGGTATTGATCCAGTCATGCTCTACGCCGTTGC
CTTGGCTGAGTCCGCCTCACATCGCGGTCTCAACATGACCAGTCCATGGCCATACGCAATTCGCAATGGT
TCAAATGCAACCTACGCCAAATCTCAGACAGAAGCGGAGCAACTGTTAAACCAAGCACTGCAAGAGAGTG
AAAAATACCAGCTCGATATTGGCCTAATGCAAATCAATTTGCATTGGCACGGACATCGGGTGAGCTCAGC
GGCGGAACTGCTAGACCCCATCACCAACCTTACCGTCGGCTCCAGTATTTTGGCCGAAGCAATCAAGTCT
TCACCTAACGATTTAGAGCTTGGCATAGGCCGCTATCACAGTTGGAACGAAGAGCGTGCACGCTGGTATG
GGCAAAGAGTGCTTTCTATTTATCGCAATATTTTACATGAACTGGAGGTCCGTCAATGA
 Primer design