SecReT4
Protein ID: 197286277
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2431
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2655818..2659387 [-]
Productpilus assembly protein
Component typeTraG_F
UniProt IDB4EWP8
KEGG IDpmr:PMI2431
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-102, Aligned region: 3..462
Protein Sequence: 1189 a.a.     [Download]
>gi|197286277|ref|YP_002152149.1| pilus assembly protein [Proteus mirabilis HI4320]
MWEIYSIGDSAFLEQVLNAVAMITGTGDFTSMVRIGLLIGVLMVSVQALMQGGRGINFQHVLVSWLVFAT
MFGPSTRVSIEDAYTGQVRVVDNVPIGVAAAGSTISTVGFQITRLFETAFSTPAMTEYGFASSLQSLIKV
RKQVMDRSGLGDANRVAGSDIEQSWFNYIKECTLIGIDIGQKNLDQVLSDPNPMTAIRFDSRIYGTRIML
SGSSSDLDCTDAYSQLKLMTESTFIPRLKQVLSASLGTSSATDTDDVIRNALNNLGLASVNTQEYMTASV
LLPIYEQSVTGKYMDDQAFTAAVMVNQAIEQRNTQWAAEQTLFQSIVRPMMTFFEGFIYAITPLMAFVIA
LGQIGMRMAGKYLLILLWIQLWMPVMAIINLYIHLTVAGKMSALDAFAGTEVPSFAGMMQMDSVLQTWIA
TGGMLASSVPAISLMLVYGSAITATHLAGRLQNGDAIDEKMASPDVAKNAPVMQSQSMFQNSALTGSAMT
GASNLLSSFSVGNAVGSMVGSAKESMTQATQAFSRQVGNTMSRTFGEKLSYDNLSSVGRQIGSSNSASSA
VVNQVTDDLQTRYGFGDDKKDAVRGLVSGVLSGGLRVGGDGTITNPGEKEVADKGFLGRLLGTGGNDSPQ
GNLPGVDKPDSSRVPKLSRVRAGLDLGGNFSGQVESSEGSSRSTTANTLTGEMQSLASSDSRRAEFRDAM
VKDLSDSRRSGVEMSLSNQDYQSLQSSAQDVITASNRFSELDQASYSLSGQRNTDGATLTRLAADNPEVM
DYLGRYMNQHVEAGNRLRENLPMYQRLLPDDNQAYVAAAMESLTYSNSSTPAERDNDYQAAMTVMAMATG
ADLRSIQPRSNEGLSSTAPTFGGTQSQVESGVLGGYEDAATVQTQFNSAQSAYQTNLSGVDGQLNAHQQQ
AQQAVASDTSTYQSGLNSEAGSQWRSRIMADDSGVSGAEMFFNSASAIGDFSGKHTDAALHTLNHFGEDY
ESYKEQALAEPGSRGFLHNATVASKSTWDGLKAAVDAGTSLENPLTAFNDAYSGSSSQYASEVNWGTKSE
AMLAGAFGAAVNNRYGEFLEQYADDFKQEAYSEGQRMGLTPIQSQVFAQAFNEGLAGRVFNSEDSSSWSP
EMLGLREQMLNEYRQKDESGAYIPDSVSEEDKAFVDKQIAVISNASLAGDYAQNNLIDIRAYNQASGRN
 
Nucleotide Sequence: 3570 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2659387-2655818 Proteus mirabilis HI4320 chromosome, complete genome
ATGTGGGAAATCTATTCCATCGGGGATTCGGCTTTTTTAGAGCAGGTCCTGAACGCTGTCGCGATGATCA
CTGGTACAGGCGATTTTACTTCAATGGTTCGCATTGGCTTGCTCATTGGGGTATTGATGGTCTCTGTTCA
GGCCTTAATGCAAGGCGGTCGTGGGATTAACTTTCAACACGTTTTAGTCTCATGGCTAGTCTTTGCAACC
ATGTTTGGACCCAGTACCCGAGTGAGCATTGAGGATGCGTACACGGGACAAGTTCGAGTGGTTGATAATG
TGCCCATCGGTGTTGCTGCCGCAGGCAGTACGATTTCGACTGTTGGCTTTCAAATCACGCGATTGTTTGA
AACGGCGTTCTCAACTCCCGCCATGACGGAATACGGCTTTGCATCCAGTTTACAGTCACTGATTAAAGTG
AGAAAACAGGTGATGGATCGCTCTGGGTTGGGTGATGCAAATCGTGTCGCCGGTTCGGACATCGAGCAAT
CGTGGTTTAACTACATCAAAGAGTGCACCTTGATTGGTATCGACATTGGCCAAAAGAACCTCGATCAGGT
GCTGAGTGACCCCAACCCAATGACTGCGATTAGGTTTGATTCGCGTATTTATGGCACACGCATCATGCTC
AGTGGTAGCAGTAGCGATCTGGACTGCACCGATGCCTACAGCCAACTGAAACTCATGACAGAATCAACCT
TCATTCCAAGGCTTAAACAGGTTCTGTCGGCCTCATTGGGGACTTCGTCAGCAACGGACACTGATGACGT
GATCCGAAATGCACTGAATAATCTTGGTTTGGCCTCGGTTAACACCCAAGAGTACATGACCGCGTCGGTG
CTTTTGCCTATTTATGAGCAAAGCGTGACGGGCAAGTATATGGATGATCAAGCTTTCACCGCCGCCGTGA
TGGTTAACCAAGCGATTGAGCAGCGCAATACGCAATGGGCGGCGGAGCAGACCCTGTTCCAAAGTATCGT
TCGTCCGATGATGACGTTTTTTGAGGGTTTCATTTACGCCATCACCCCATTGATGGCCTTTGTGATTGCC
CTTGGCCAAATCGGGATGCGAATGGCCGGGAAGTACTTGTTAATCCTGCTTTGGATTCAACTTTGGATGC
CTGTCATGGCCATCATTAACCTATATATCCATTTAACTGTAGCTGGGAAAATGTCGGCTCTTGATGCCTT
TGCAGGTACAGAAGTGCCATCTTTTGCTGGGATGATGCAGATGGATTCAGTGCTGCAAACCTGGATAGCT
ACTGGCGGCATGTTGGCGTCGAGTGTTCCGGCGATTTCGCTCATGCTCGTGTATGGCTCAGCAATAACCG
CTACCCACTTGGCTGGACGTCTTCAAAACGGTGATGCAATTGATGAAAAGATGGCAAGTCCAGATGTCGC
GAAAAATGCCCCGGTGATGCAATCACAGTCAATGTTCCAAAATTCAGCCCTCACTGGTTCTGCTATGACC
GGCGCGTCAAACCTACTAAGCAGTTTCTCTGTCGGAAACGCAGTGGGTTCAATGGTCGGCTCTGCAAAAG
AATCCATGACTCAGGCAACTCAAGCCTTTAGCCGTCAGGTTGGCAATACCATGAGTCGAACCTTTGGTGA
AAAGCTAAGTTACGACAACCTTTCTTCGGTTGGACGTCAGATCGGTTCTTCTAATTCCGCATCTAGCGCC
GTTGTTAATCAGGTTACTGATGACCTGCAAACACGGTATGGTTTCGGAGACGATAAAAAAGACGCTGTAC
GTGGCTTGGTATCGGGCGTGTTATCGGGAGGCCTTAGGGTTGGTGGCGATGGAACCATTACTAATCCCGG
TGAGAAAGAAGTTGCCGATAAGGGTTTTCTTGGGAGGCTTCTTGGAACGGGAGGCAATGATTCTCCACAA
GGTAATTTGCCTGGAGTTGATAAGCCAGATTCATCTCGTGTACCAAAACTATCAAGGGTACGAGCTGGGT
TGGATCTAGGTGGTAACTTTAGTGGCCAAGTTGAGTCGTCAGAAGGCAGTTCTCGGTCTACGACCGCAAA
TACGCTCACTGGGGAGATGCAAAGCTTGGCATCGAGTGATTCACGACGTGCTGAGTTTCGCGATGCGATG
GTTAAGGACCTTTCAGATTCAAGACGCTCTGGCGTTGAGATGTCGTTGTCTAATCAAGACTATCAGTCAC
TTCAGAGTTCAGCACAAGACGTTATCACGGCATCAAACCGCTTTAGTGAGCTTGATCAGGCCAGCTACAG
TCTATCAGGACAAAGGAACACGGATGGTGCGACGTTAACTCGATTAGCAGCGGATAATCCTGAAGTCATG
GATTATTTAGGTCGCTATATGAACCAGCATGTTGAAGCAGGTAACCGATTACGTGAAAACCTTCCAATGT
ATCAGCGCTTGCTACCTGATGATAATCAGGCGTATGTGGCCGCAGCTATGGAGTCTTTAACCTATAGCAA
CTCCTCTACGCCCGCTGAACGAGACAATGACTATCAAGCAGCAATGACTGTTATGGCCATGGCTACCGGA
GCCGATTTACGATCTATTCAGCCACGCTCTAATGAAGGCTTGTCATCAACGGCACCTACTTTTGGTGGCA
CTCAAAGCCAAGTTGAATCCGGTGTTCTGGGAGGCTATGAGGATGCTGCAACAGTTCAAACGCAGTTCAA
TTCGGCTCAATCTGCTTACCAAACCAATCTTTCTGGTGTAGATGGACAGCTGAATGCGCATCAGCAACAA
GCCCAGCAGGCCGTAGCTTCTGACACAAGTACCTATCAATCTGGACTAAACAGTGAAGCTGGCTCTCAGT
GGCGATCTCGCATTATGGCTGATGATAGCGGAGTCTCTGGTGCTGAAATGTTCTTCAACAGCGCCAGTGC
TATTGGTGATTTCAGTGGCAAGCATACTGATGCAGCATTGCATACCTTGAATCATTTTGGCGAAGACTAT
GAGAGTTACAAGGAGCAAGCCCTTGCAGAACCTGGCTCACGAGGTTTCTTGCACAATGCAACTGTGGCCA
GCAAATCAACATGGGATGGGTTAAAAGCAGCCGTTGATGCCGGAACCTCTTTGGAAAATCCTTTGACGGC
GTTTAATGATGCATACAGTGGATCGAGTTCGCAGTATGCCTCCGAAGTAAACTGGGGCACTAAGTCTGAA
GCCATGTTGGCGGGGGCATTCGGTGCGGCAGTTAACAATCGATACGGTGAGTTCTTAGAACAGTACGCCG
ATGATTTTAAACAGGAAGCATACAGCGAAGGGCAGAGAATGGGATTGACCCCGATTCAAAGTCAAGTGTT
TGCTCAAGCTTTCAATGAAGGTTTGGCGGGGCGCGTATTCAACTCTGAAGACTCATCGAGTTGGTCGCCT
GAAATGCTAGGTCTAAGGGAGCAAATGCTAAATGAGTATCGTCAAAAGGATGAGAGTGGCGCTTACATTC
CTGACAGTGTGTCCGAAGAAGATAAAGCATTTGTGGATAAGCAGATAGCGGTGATCTCAAATGCATCGCT
TGCGGGAGATTATGCTCAGAACAACTTGATCGATATTAGGGCCTATAATCAGGCATCAGGAAGGAACTGA
 Primer design