SecReT4
Protein ID: 197286278
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2432
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2659391..2660779 [-]
Productpilus assembly protein
Component typeTraH_F
UniProt IDB4EWP9
KEGG IDpmr:PMI2432
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 6.7e-103, Aligned region: 28..389
Myb_Cef [PF11831], Evalue: 9.3e-06, Aligned region: 367..456
Protein Sequence: 462 a.a.     [Download]
>gi|197286278|ref|YP_002152150.1| pilus assembly protein [Proteus mirabilis HI4320]
MKKVFRVSLIACAIGFSSMSQASLQQEMNQLFGSMTNTTAPGVFESQRRGVISGGSVVVRNRIMNENLVS
MVPPSFQAGCGGIDMFAGSLSFVNADQFVQLLRSVAANAKGYAFQLALSAMCEKCSQHMETLQKKIQQLN
EYFGNSCQMAQGVVNDTLAAFGKKGQTEASMLSSLKGAGDIFTSWSESNGKNPYENASSVAASDVNKTIK
GNLVWRALKRHSASSWFASGDDRFLEAVMSVTGSIIVGDLANAADGQGKAPKLTRLNGNKVTIEHLIHGG
NVAMYRCDTVTQDGCLNPTITNVTLTGLSTQVENLLLGTGSSNGIIFKFARNTGAASTTEKAFMTSAPAS
IGGMIRTLSALNEGAARSFASRAAPFIAVEMARALVEDMLNAARSTSGVEDHAYAKLLTEDLERARRQIN
DEYAALQRRYGSEQELLAHFNQVIQTIRKQRYYTVKSTALGE
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2660779-2659391 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAAAAGTATTCCGAGTATCGCTTATCGCCTGTGCGATTGGTTTTTCATCTATGAGCCAAGCAAGCT
TGCAACAGGAGATGAATCAGTTGTTTGGTTCAATGACCAACACCACTGCGCCTGGTGTATTCGAGAGTCA
GCGGCGTGGCGTTATATCTGGTGGAAGCGTTGTTGTCCGTAACAGGATCATGAACGAAAACCTCGTCTCA
ATGGTGCCTCCTTCATTCCAAGCAGGTTGTGGCGGCATTGATATGTTCGCTGGAAGTTTGTCATTTGTTA
ATGCAGATCAGTTTGTTCAATTACTTCGCTCTGTAGCGGCAAATGCCAAGGGATACGCATTCCAATTAGC
GCTCAGTGCTATGTGTGAGAAATGCTCTCAGCACATGGAGACACTGCAAAAGAAAATACAGCAGTTGAAC
GAGTATTTTGGCAATTCCTGTCAAATGGCTCAGGGAGTCGTGAACGATACCCTGGCTGCTTTTGGTAAAA
AGGGGCAAACAGAAGCCAGCATGTTGAGCTCACTTAAAGGGGCTGGAGACATTTTTACCAGTTGGAGTGA
GTCCAATGGTAAGAACCCTTATGAGAACGCTTCAAGTGTCGCGGCATCGGATGTGAACAAAACAATTAAA
GGTAACTTGGTCTGGCGAGCACTGAAACGTCACTCGGCATCAAGCTGGTTTGCATCGGGGGATGATCGTT
TTCTTGAAGCGGTTATGTCGGTGACTGGTTCGATCATCGTTGGTGATTTAGCGAATGCCGCTGATGGCCA
AGGTAAAGCCCCAAAACTGACCAGACTAAATGGCAATAAAGTGACTATTGAGCATCTAATTCATGGCGGT
AACGTCGCTATGTACCGATGTGACACAGTGACGCAAGACGGTTGTCTGAACCCAACAATCACTAACGTGA
CTCTTACCGGGTTATCAACTCAGGTAGAAAATTTACTTCTTGGTACAGGTTCTAGTAACGGCATTATTTT
TAAGTTTGCTCGAAATACAGGGGCTGCTAGCACCACCGAAAAGGCTTTTATGACCTCGGCTCCTGCGAGT
ATTGGCGGCATGATTCGAACACTTTCTGCATTAAATGAAGGGGCCGCTAGGTCGTTTGCTTCACGAGCGG
CACCATTTATTGCTGTTGAGATGGCCCGGGCATTGGTTGAAGACATGCTCAATGCAGCTAGAAGCACATC
GGGTGTGGAAGATCATGCCTATGCGAAGTTGTTAACCGAAGACCTTGAACGTGCACGTCGCCAAATCAAT
GATGAGTACGCTGCGTTGCAGCGAAGATACGGCTCAGAGCAAGAATTGCTGGCGCATTTTAACCAGGTGA
TTCAGACCATTCGCAAACAGCGTTATTACACCGTTAAATCTACGGCGCTGGGGGAATAG
 Primer design