SecReT4
Protein ID: 197286279
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2433
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2660782..2661726 [-]
Productpilus assembly
Component typeTraF_F
UniProt IDB4EWQ0
KEGG IDpmr:PMI2433
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3e-72, Aligned region: 41..260
Protein Sequence: 314 a.a.     [Download]
>gi|197286279|ref|YP_002152151.1| pilus assembly [Proteus mirabilis HI4320]
MRTPLLPWFILWVTIPIIIFFLFILPAYASDEPFYQRGQEGWFWYQVIPGPAEAEELIKPESGAAESSKS
GLKPFSAAWFREHMQSFMDKAIDEPTSENVRAYLYLQRVMMDKGSLFADVSQQVVMGDPVLDEISRRPLA
TYAANRMDREAGAQRDVALGEVAKRAGLFFFYRSDCPYCHAQAPIIESMALNYGFEVFAIAVDGLPLPGG
EFPNYKVDSGQAQSLSVTTVPAVFLVDPPNVITPIGQGAMSLDELNNRIILAAHQAGWIDDQTYYATRPV
QPGVSLAMSAQELNEKILQNPEFLVRYLRAQGGL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2661726-2660782 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGAACGCCTTTGTTACCTTGGTTTATCCTATGGGTGACCATCCCAATCATTATTTTCTTTCTATTCA
TCTTACCCGCCTATGCCAGTGACGAGCCATTCTATCAGCGTGGTCAGGAAGGCTGGTTTTGGTATCAAGT
CATTCCTGGGCCAGCGGAGGCTGAAGAGCTTATTAAGCCGGAATCTGGTGCGGCAGAGTCGAGTAAGAGC
GGGCTAAAGCCTTTCAGTGCTGCCTGGTTTCGTGAGCACATGCAGTCGTTCATGGACAAGGCAATTGATG
AGCCAACGAGTGAGAATGTCAGAGCCTATCTTTATCTTCAGCGCGTCATGATGGATAAGGGCTCACTATT
TGCTGATGTTAGTCAGCAGGTGGTCATGGGCGATCCTGTTTTGGATGAAATCAGTCGCAGACCCTTGGCG
ACTTATGCTGCCAATCGGATGGATCGAGAAGCTGGCGCTCAACGTGATGTAGCTTTAGGTGAAGTAGCAA
AACGGGCTGGCTTGTTCTTTTTCTATCGTTCGGATTGTCCTTACTGCCATGCTCAAGCTCCTATCATCGA
ATCCATGGCTTTGAACTACGGTTTCGAGGTGTTTGCTATTGCTGTCGATGGCTTGCCTTTACCTGGTGGA
GAGTTTCCTAATTACAAAGTCGATTCAGGACAAGCTCAATCATTGTCAGTTACGACTGTCCCTGCCGTGT
TCTTAGTTGACCCGCCTAACGTCATAACTCCGATTGGCCAAGGTGCAATGAGCCTCGATGAGCTCAATAA
TCGAATCATTCTCGCAGCCCATCAAGCCGGTTGGATTGACGATCAAACTTACTATGCCACCAGACCTGTT
CAACCCGGCGTGTCACTTGCGATGTCAGCCCAAGAGCTTAACGAAAAGATATTACAGAACCCTGAGTTTC
TTGTTCGCTATCTGCGTGCACAAGGAGGGTTATAA
 Primer design