SecReT4
Protein ID: 197286302
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2456
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2682565..2686257 [-]
Productmating pair stabilization protein
Component typeTraN_F
UniProt IDB4EWS3
KEGG IDpmr:PMI2456
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.1e-87, Aligned region: 373..462
TraN [PF06986], Evalue: 1.1e-87, Aligned region: 740..1005
TraN [PF06986], Evalue: 1.1e-87, Aligned region: 1072..1148
Protein Sequence: 1230 a.a.     [Download]
>gi|197286302|ref|YP_002152174.1| mating pair stabilization protein [Proteus mirabilis HI4320]
MKPTLFTRVLAGVLSITMACLPLHGVAADVQRQSGLSGQQEGKQLLQNWTMPALNGNTLSVPNGSGNESI
NLQELFPGMDQGSLDVLTGVYGSDASMNQLGTQRQESMASESGATGEAFRSLQQIKDRSRPDMVNDPLWA
LTDAVQTDPNLLTQSFPGCESQGEGSPNYQQCDRLNTAVNSCTITHDYTAGIIEHVSGPMNLRSCGEGCL
EVWIGRIGDNYWSGRCKVFEQAITLKVVNPDAITSAVLEYAKWDDYMQVWLGDQKVWSGPNNNFPPETAG
RCELSTSWERNPNTDLTARLKAVEPGLEVPVKIRVSVTGSGEGYARIKVRFDPTKVVMNDSWSPQSCIEQ
AADIPAKFSDYSIQCTDQPSSTNGCTVVNGVSVCESYFAPSPVAGISPLCRRVQVSVDDESYKGIENQAC
QVLEANPSCGFMSSECAETNDKGECIRFTDTYDCGLQTSDPKCVVSNLMPSSFEACEPTQTITPFTETKH
VPDYQVCEKISTLTQCQLERRVSAETHQQSWSIERGCFSSEIISFVPQHSTTMQTGNATLRIFDNQNTEI
KITESPSKANGWKTTLSLKGNKETVTETKPSIKYPEMTCPKGTLVGSLCKVVNGSIISWHEPQEVTRSKC
ESGWNKVDFDTCSREVQKCLAPGKLSASLAFSGKYLEQDVVHQSSDPGIDQCLMQTDQFTAVQWRCLDTG
TKRIDGLTVGSGELANLGSLYPAVVSSPAHLTSRGSSDGLGLSCWRARATYNASTSHPEFNMGSSDSWVD
ANGNTQTIVNNGQNTTTNTCAALEQNPACQYVRTECTEGGAGHEGFCYIQSLVYDCGQSVEVQNARMETQ
YNCEGPVRCMGTDCLEPESIKQANFAEAAAMLNAAQFMTNDMSCTGADGQDNVECTVFKGNAGQCKKAVG
GIVDCCEKPSGVSLSDYITMIVAVNKLDTAVMAMNPSSAIYGSWNTLREPITSTWSAVKEPFVSAWDSLM
GAGPSTAAGAGAEQAATGFMQVLTNKTAEWVGTTFGSGAQSALFSNVGGAVGADGVVSGGNFALGGAAGA
VLSTVMTAYMIYSVTMILIQLIWKCEQSEFEMNAKRVLKSCHYVGSYCKSKFLGACVEKRQSYCCFTSPL
SRIIQEQVRPQLGLGWGSAKSPNCEGLTASQLNQVDWSQVNLDEWIGILSITGNLPEVPSLDLERLTGSG
STLNVDGNRQSAADRAIERLNGMDAQKLRQEATEEISGNN
 
Nucleotide Sequence: 3693 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2686257-2682565 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAACCAACACTTTTTACCCGAGTTTTAGCGGGTGTTTTATCAATCACTATGGCGTGCTTGCCCTTAC
ATGGTGTGGCCGCTGATGTACAGCGCCAATCCGGCCTAAGCGGACAACAAGAAGGTAAGCAATTGCTGCA
AAACTGGACGATGCCCGCACTCAATGGCAATACATTGTCGGTGCCGAATGGCAGTGGTAATGAGTCCATT
AACTTGCAAGAGCTTTTCCCTGGTATGGATCAGGGCTCATTGGATGTCTTAACGGGCGTTTATGGCTCTG
ATGCCAGCATGAATCAATTGGGGACACAGCGCCAAGAGAGCATGGCATCCGAAAGTGGCGCTACGGGTGA
AGCATTTCGTTCGCTACAGCAAATCAAAGACAGGTCTCGGCCAGATATGGTCAATGATCCGCTTTGGGCA
TTAACTGATGCGGTTCAAACTGACCCAAATCTATTAACACAAAGCTTCCCAGGCTGTGAGTCTCAAGGTG
AAGGTAGCCCAAATTACCAGCAATGCGACAGGCTCAATACAGCGGTTAACAGCTGCACTATTACTCACGA
TTACACGGCAGGCATTATTGAGCATGTTTCAGGACCAATGAACCTTCGCTCTTGTGGTGAGGGATGTCTT
GAAGTTTGGATTGGACGAATTGGCGACAACTACTGGAGTGGCCGTTGTAAAGTGTTTGAACAGGCCATCA
CACTCAAAGTAGTGAACCCCGATGCGATTACCTCAGCCGTTCTTGAGTACGCCAAATGGGATGACTACAT
GCAAGTGTGGCTTGGCGATCAGAAAGTCTGGTCTGGGCCGAACAATAACTTTCCACCAGAAACGGCAGGT
CGCTGCGAGCTCAGTACCAGTTGGGAGCGCAATCCAAATACCGATCTCACTGCCAGGCTAAAAGCGGTAG
AACCCGGTTTAGAAGTGCCGGTAAAAATTCGCGTATCGGTTACGGGTAGTGGTGAGGGGTATGCACGCAT
CAAGGTGCGCTTTGATCCAACCAAGGTGGTGATGAATGATAGTTGGTCACCACAGTCCTGTATCGAACAA
GCCGCGGATATCCCGGCGAAGTTTTCAGACTACAGTATTCAATGCACGGATCAGCCGTCTTCAACCAACG
GATGTACGGTGGTCAATGGTGTTTCAGTTTGTGAATCCTACTTTGCCCCAAGCCCAGTGGCTGGCATATC
GCCTTTGTGTCGGCGTGTTCAAGTGAGTGTGGATGATGAAAGCTATAAGGGGATTGAAAACCAGGCCTGC
CAAGTGCTTGAAGCGAATCCTTCCTGTGGATTCATGTCGTCAGAATGTGCCGAGACCAATGATAAAGGTG
AATGCATTCGTTTTACCGATACCTATGACTGTGGATTGCAAACCAGCGATCCAAAGTGTGTGGTATCCAA
CCTTATGCCAAGTAGTTTTGAGGCCTGTGAGCCTACCCAGACGATTACGCCATTTACTGAAACCAAGCAT
GTACCGGATTACCAGGTGTGCGAGAAGATCAGCACGCTTACTCAGTGTCAGTTAGAGCGACGTGTATCCG
CTGAAACCCATCAACAAAGCTGGTCCATTGAGCGTGGTTGCTTTAGCTCTGAAATCATCAGTTTTGTTCC
ACAGCACAGCACCACCATGCAAACTGGAAACGCGACACTGAGGATTTTTGATAATCAAAATACTGAGATA
AAAATCACTGAGTCGCCATCTAAGGCAAATGGTTGGAAAACGACACTCTCTCTTAAGGGCAACAAGGAGA
CGGTCACAGAGACGAAACCGTCCATTAAATACCCTGAAATGACCTGTCCAAAAGGAACCTTGGTTGGCTC
ATTGTGCAAGGTCGTTAATGGGTCGATTATTTCGTGGCATGAACCGCAGGAAGTCACGCGTTCCAAATGT
GAGTCCGGCTGGAACAAAGTCGATTTCGATACTTGCAGCCGAGAAGTTCAGAAGTGTTTGGCTCCTGGGA
AACTGAGCGCTTCATTGGCCTTCTCTGGCAAATACTTAGAGCAAGACGTTGTTCATCAATCAAGTGATCC
GGGCATAGACCAATGCTTGATGCAAACGGATCAGTTTACTGCGGTTCAGTGGCGGTGTTTGGATACGGGC
ACAAAACGAATCGACGGGTTAACGGTTGGTAGTGGCGAGTTGGCCAATCTGGGAAGCCTTTATCCGGCGG
TTGTTTCGTCTCCTGCTCATTTAACCAGTCGCGGCAGTTCTGATGGACTGGGGCTCTCATGCTGGAGGGC
AAGAGCGACCTACAATGCTTCGACTTCTCATCCAGAGTTCAACATGGGCAGCTCAGATAGCTGGGTAGAT
GCCAATGGTAATACTCAAACCATCGTCAATAACGGACAAAACACGACCACCAATACGTGTGCCGCGCTGG
AGCAAAACCCGGCCTGCCAGTATGTCAGAACCGAATGCACTGAAGGCGGGGCTGGTCATGAAGGCTTCTG
CTATATCCAAAGTTTGGTGTATGACTGCGGACAAAGCGTTGAAGTGCAAAATGCACGAATGGAAACTCAA
TACAACTGTGAGGGGCCAGTTCGCTGCATGGGCACAGATTGTTTAGAGCCAGAGTCAATCAAGCAGGCTA
ACTTTGCAGAAGCCGCAGCTATGCTTAATGCGGCGCAGTTTATGACCAATGATATGTCATGCACGGGAGC
TGATGGCCAAGACAACGTCGAGTGTACGGTCTTTAAAGGTAATGCTGGCCAGTGCAAAAAAGCCGTTGGC
GGCATAGTGGATTGCTGTGAAAAGCCAAGTGGCGTGTCGCTATCGGACTACATCACGATGATAGTGGCGG
TCAACAAGCTTGATACGGCAGTCATGGCCATGAATCCGTCTTCGGCAATCTATGGTTCCTGGAATACGCT
CAGGGAACCAATCACCAGTACCTGGAGTGCGGTCAAAGAGCCCTTTGTGTCTGCATGGGACTCTCTCATG
GGGGCTGGGCCATCAACGGCTGCTGGCGCGGGAGCAGAGCAAGCAGCGACAGGCTTCATGCAGGTGTTGA
CCAACAAAACGGCTGAATGGGTAGGTACGACCTTTGGTTCGGGGGCACAATCGGCTCTGTTTAGTAACGT
TGGTGGCGCGGTTGGAGCCGATGGTGTCGTTTCGGGTGGTAACTTTGCGCTGGGTGGCGCTGCGGGCGCG
GTTCTGAGTACGGTTATGACGGCCTACATGATTTATTCAGTCACCATGATCCTCATTCAGCTTATCTGGA
AATGTGAGCAGAGTGAGTTTGAGATGAACGCTAAGCGGGTATTGAAGAGTTGCCACTACGTAGGCTCTTA
CTGCAAGTCTAAGTTCTTAGGTGCCTGTGTTGAGAAACGGCAATCATATTGCTGCTTTACTTCGCCGCTT
TCACGGATTATTCAAGAACAAGTACGTCCTCAATTGGGCCTTGGTTGGGGCAGTGCCAAGTCACCAAACT
GTGAAGGTTTGACCGCGAGTCAGTTAAACCAGGTAGATTGGAGCCAAGTCAATCTGGATGAATGGATAGG
TATTTTGTCGATCACGGGCAACCTACCTGAAGTGCCGTCACTGGATCTGGAACGACTCACCGGCTCAGGA
AGCACGCTAAACGTTGATGGAAATCGTCAGAGTGCCGCAGACAGGGCCATTGAACGGCTAAACGGCATGG
ATGCCCAGAAACTGCGTCAGGAGGCGACGGAAGAAATTTCTGGAAATAATTGA
 Primer design