SecReT4
Protein ID: 197286303
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2457
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2686260..2687288 [-]
Productplasmid pilus assembly
Component typeTraU_F
UniProt IDB4EWS4
KEGG IDpmr:PMI2457
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.2e-69, Aligned region: 43..339
Protein Sequence: 342 a.a.     [Download]
>gi|197286303|ref|YP_002152175.1| plasmid pilus assembly [Proteus mirabilis HI4320]
MKKLNNTYRLMRTLVVMLVLGASIPAKAELTCPDAGLLSGKLLTDVCWSCIFPIRVAGLPLGSGNVPSGA
SNKSFCLCEDNLGVPRPGIVTSMWEPARLIELVRTPGCSPSLGGIRLPLGDRRLQGGHGEGEYDTGDLAF
YHYHYYAFPLLVMLDLFMDGNCNADGYMDFDLMYLSELDPTWLNDELAFFTQPEAAAVANPLAISACTAD
AASSTLGKPIDQLFWCAGSWGHLYPLSGHTLAFGSLAENTSHLAARAIAAQHRRGLARRTMGNSALCRPV
IEPMLPKSQYKMSMFFPVPETESAHVIGESTMKWGEWRTIPGAGEDALYILWRWQDCCNSGG
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2687288-2686260 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAAAGCTCAATAATACGTATCGTCTGATGCGGACTCTCGTTGTCATGCTTGTCCTGGGCGCATCTA
TTCCTGCAAAAGCCGAATTGACTTGCCCAGACGCGGGGTTATTGTCCGGCAAGTTGCTGACGGATGTTTG
CTGGTCATGCATTTTTCCTATCCGGGTTGCCGGTCTTCCTCTTGGTTCTGGAAATGTCCCAAGCGGCGCA
TCAAACAAGTCATTTTGCTTGTGTGAAGACAACTTAGGCGTGCCAAGGCCAGGTATTGTTACCAGCATGT
GGGAGCCAGCGCGTCTGATTGAACTGGTCAGAACGCCGGGTTGTTCGCCTTCCCTGGGAGGGATTCGTTT
ACCGTTAGGTGATAGACGACTGCAAGGTGGTCATGGTGAAGGTGAATACGATACCGGTGATCTTGCTTTC
TACCATTACCATTATTACGCCTTTCCGCTTTTGGTCATGCTCGATTTGTTCATGGATGGCAATTGCAATG
CCGATGGTTACATGGACTTTGACTTGATGTATTTGTCGGAATTGGACCCAACATGGCTGAACGATGAACT
GGCCTTTTTTACTCAGCCTGAAGCGGCTGCCGTTGCCAATCCATTGGCTATATCTGCTTGTACCGCTGAC
GCTGCTTCATCAACGCTTGGTAAACCCATCGACCAGTTGTTTTGGTGTGCTGGCAGTTGGGGCCATCTCT
ATCCGTTATCTGGCCACACCTTAGCCTTTGGCTCATTAGCAGAAAATACCAGCCATTTAGCGGCGCGTGC
AATCGCGGCTCAACACAGGCGTGGTCTTGCTAGGCGAACAATGGGGAACAGTGCGCTATGCCGACCTGTT
ATCGAACCCATGCTGCCGAAATCCCAATACAAGATGAGTATGTTCTTCCCTGTACCGGAAACTGAAAGTG
CGCATGTCATCGGTGAAAGCACCATGAAATGGGGAGAGTGGCGAACAATCCCTGGTGCCGGTGAAGATGC
GCTCTACATTTTGTGGCGCTGGCAAGACTGCTGTAACTCGGGAGGTTAA
 Primer design