SecReT4
Protein ID: 197286304
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2458
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2687272..2688399 [-]
Productplasmid pilus assembly protein
Component typeTraW_F
UniProt IDB4EWS5
KEGG IDpmr:PMI2458
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.6e-23, Aligned region: 74..190
Protein Sequence: 375 a.a.     [Download]
>gi|197286304|ref|YP_002152176.1| plasmid pilus assembly protein [Proteus mirabilis HI4320]
MMRRPCLLFLLVAPLAWVQVSWAQEPYPLSDEDKKIVEMSRSILQSAVDGSSEFIEPFSPIEQPASLKHN
DEWLIFASSSLGDSSLKQLFKEASATGAIVLFRGIPEGKTLGAAIRDWHTLMVGLDPVPQVRIDPKAFVH
WRVTSVPAIFRIEDDKVTASALGVYSKDWLQRQIETGNTGSLGQRGPIHSILEPDLMQVAMQRLQSLDLG
ALKKKAIERFWSRQTFTDLPKATQYRIRTVDPTIVMQRPLLDANGRTLIPAGTRINPLKALPFTQQLVVF
NASNAEEVDAVAHWLETQDRTLRRITLITTQLDRTQGWNSLNALEKTLDSPVYLLNASLKQRFDLQVTPS
FVQAKGLAFEIEEIPAKELVHEKAQ
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2688399-2687272 Proteus mirabilis HI4320 chromosome, complete genome
ATGATGAGAAGACCATGCCTCTTATTTTTGTTGGTTGCTCCATTGGCTTGGGTTCAAGTGTCCTGGGCAC
AAGAGCCTTATCCGTTGTCTGACGAGGACAAAAAGATCGTTGAAATGAGCCGCAGCATTTTACAAAGTGC
TGTGGATGGTTCATCTGAATTTATCGAGCCTTTTTCACCGATTGAACAACCTGCGTCGCTCAAACACAAC
GATGAATGGTTGATTTTTGCGTCGTCTTCACTGGGGGATTCCTCACTGAAGCAGCTATTTAAAGAGGCCA
GTGCAACCGGCGCTATTGTGTTGTTTCGGGGAATTCCTGAAGGAAAGACCTTGGGGGCGGCTATCCGTGA
TTGGCATACGCTGATGGTGGGACTTGATCCTGTTCCTCAGGTTCGAATCGATCCGAAAGCCTTTGTGCAC
TGGCGGGTGACTAGCGTGCCTGCCATTTTCCGCATAGAAGATGACAAGGTGACTGCAAGTGCACTAGGGG
TTTACAGCAAGGACTGGTTGCAGCGTCAAATTGAAACAGGCAATACCGGTTCATTGGGTCAACGCGGTCC
GATTCATTCCATTTTAGAACCGGATTTGATGCAAGTGGCGATGCAGCGTTTACAGTCGCTTGACCTGGGC
GCGTTAAAGAAAAAAGCCATTGAGCGATTCTGGTCTCGCCAAACTTTCACTGACTTACCCAAAGCCACGC
AGTATCGGATAAGAACGGTTGATCCAACCATCGTCATGCAGCGGCCACTATTGGATGCCAATGGCCGAAC
ATTGATCCCAGCAGGAACGCGTATTAACCCGCTAAAAGCCTTGCCGTTTACTCAGCAGCTTGTGGTGTTT
AATGCGTCGAACGCTGAAGAAGTGGACGCAGTTGCGCATTGGCTTGAGACGCAAGATAGGACACTGCGCC
GCATTACGCTTATCACCACGCAGCTCGACCGTACTCAAGGTTGGAATAGCCTAAATGCGCTCGAAAAGAC
ATTGGATAGTCCGGTTTACCTTCTCAATGCCTCGCTAAAGCAGCGCTTTGATTTGCAAGTCACCCCATCG
TTTGTTCAAGCAAAGGGGCTCGCGTTTGAAATAGAAGAAATTCCAGCAAAGGAGCTTGTTCATGAAAAAG
CTCAATAA
 Primer design