SecReT4
Protein ID: 197286307
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2461
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2689243..2691642 [-]
Productplasmid pilus assembly protein
Component typeTraC_F
UniProt IDB4EWS8
KEGG IDpmr:PMI2461
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.1e-57, Aligned region: 437..713
TraC_F_IV [PF11130], Evalue: 4.7e-54, Aligned region: 9..242
Protein Sequence: 799 a.a.     [Download]
>gi|197286307|ref|YP_002152179.1| plasmid pilus assembly protein [Proteus mirabilis HI4320]
MKASLYSGQRASELLPVLAYSDDEQLFFMEDQSVGFGFLCDPLPGGDESVADRVNVLLNNDWPKDTLLQF
GLYASPDIQTDLQRMMGLRHRQSDPLLRASIRKRADFLDGGTVQPIEESTQTQVRNFQLIVTCKLPLESP
IPTERELSRASALRASFSQALATVGFRVTEMTDRNWLAALSAQLNWGKDASWRNPSPIRSEADKPLREQV
LDYDRAIKVDSQGLMLGDYRVKTLSFKRLPERIWFGHAASFAGDMMTGSRGLRGSFLLNVTIHFPSAEAM
RSRLETKRQWAVNQAYGPMLKFVPVLAAKKKGFDVLFEALQEGDRPIRANMTLTLFSPTEEASISSVSNA
RTYFKELGFELMEDKYFCLPIFLNALPFGADRQAMNDLFRFKTMATRHVIPLLPLFADWKGTGTPVINFV
SRNGQIMSVSLYDSGSNYNCCIAAQSGSGKSFLVNEIISSYLSEGGQCWVIDVGRSYEKLCEVYDGEFLQ
FGRDSGICLNPFEIVEDYDEEADVLVGLLAAMAAPTQSLTDFQMANLKRQTRELWEKKGRAMLVDDVAEA
LKNHDDRRVQDVGEQLYPFTTQGEYGRFFNGHNNIRFKNRFTVLELEELKGRKHLQQVVLLQLIYQIQQE
MYLGERDRRKIVFIDEAWDLLTQGDVGKFIETGYRRFRKYGGSAVTVTQSVNDLYDSPTGKAIAENSANM
YLLGQKAETINALKKEGRLPLGEGGYEYLKTVHTVTGVYSEIFFITEMGTGIGRLIVDPFHKLLYSSRAE
DVNAIKQLTRKGLSVADAISQLLKERGYE
 
Nucleotide Sequence: 2400 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2691642-2689243 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAGCCTCTCTGTATTCAGGGCAACGCGCTTCTGAGCTATTGCCAGTATTGGCCTATTCAGACGATG
AGCAACTGTTTTTCATGGAAGACCAGAGTGTTGGCTTTGGTTTTCTATGTGACCCATTGCCGGGTGGTGA
TGAGTCTGTTGCAGACAGGGTTAATGTTCTTCTCAACAACGACTGGCCAAAAGACACTTTGCTGCAATTT
GGCCTGTACGCCTCGCCTGATATTCAAACCGACCTTCAGCGCATGATGGGCTTACGGCATCGTCAATCCG
ATCCATTACTCAGGGCGTCGATACGCAAACGTGCGGATTTTCTCGATGGGGGCACGGTTCAACCGATAGA
AGAATCGACCCAGACTCAGGTACGCAACTTTCAACTGATAGTCACCTGCAAATTGCCTTTGGAAAGTCCT
ATACCGACTGAGCGTGAATTAAGTCGAGCATCCGCGCTTCGGGCTTCTTTCTCTCAAGCGCTGGCAACGG
TTGGTTTTCGCGTCACTGAGATGACTGACCGAAACTGGCTCGCGGCATTAAGTGCGCAGCTTAACTGGGG
AAAAGATGCTTCCTGGCGTAATCCATCACCAATCCGCAGTGAGGCAGATAAGCCACTTCGAGAGCAAGTG
TTGGATTATGACCGGGCTATCAAAGTGGATAGTCAAGGTCTGATGCTGGGTGATTACCGAGTTAAAACCC
TATCGTTTAAGCGCCTGCCTGAGCGGATCTGGTTTGGTCATGCCGCAAGTTTTGCGGGCGACATGATGAC
GGGCAGTCGCGGTTTACGCGGCAGCTTTTTGCTAAATGTCACCATTCACTTTCCCTCAGCTGAGGCGATG
CGATCTCGTTTAGAGACGAAGCGTCAATGGGCGGTCAATCAGGCCTATGGCCCGATGCTCAAGTTTGTGC
CGGTGCTTGCAGCCAAGAAAAAGGGATTTGATGTTCTTTTTGAAGCCTTGCAAGAAGGTGATCGTCCTAT
TCGGGCAAATATGACTTTGACGCTGTTTTCACCAACGGAAGAGGCGTCCATCAGCTCTGTTTCAAATGCT
CGAACTTATTTCAAAGAACTCGGATTTGAGCTGATGGAAGACAAGTACTTCTGTTTGCCAATTTTCTTGA
ATGCCCTGCCATTTGGTGCCGACCGCCAGGCGATGAACGACTTGTTTCGATTCAAGACCATGGCGACACG
GCATGTGATCCCTCTGTTGCCTTTGTTTGCGGATTGGAAAGGCACGGGCACGCCAGTGATTAACTTTGTT
TCCCGTAATGGTCAGATCATGAGTGTGTCCCTTTATGACTCGGGCAGTAATTACAACTGTTGCATCGCGG
CGCAATCGGGGTCGGGTAAGTCATTCCTGGTGAACGAAATCATCTCCTCCTACTTATCTGAAGGCGGCCA
ATGCTGGGTGATTGATGTTGGCCGCTCTTATGAAAAGCTGTGTGAAGTCTATGATGGTGAGTTCTTACAG
TTCGGCCGGGACAGTGGCATTTGCTTGAATCCGTTTGAAATCGTTGAGGACTATGACGAAGAAGCGGATG
TGTTGGTTGGGTTATTGGCCGCAATGGCCGCACCTACGCAGTCATTAACCGATTTTCAGATGGCCAACCT
AAAACGTCAGACCCGTGAACTGTGGGAGAAAAAAGGTCGTGCGATGTTGGTTGATGATGTGGCAGAGGCT
TTGAAAAATCACGATGACCGTCGTGTGCAAGACGTGGGTGAGCAGCTCTATCCGTTTACGACACAAGGCG
AATATGGCCGCTTCTTTAATGGCCACAACAATATTCGCTTCAAAAACCGTTTCACCGTTCTGGAGTTAGA
AGAGCTCAAGGGGCGTAAGCACCTGCAACAAGTGGTGTTGCTTCAGCTTATCTACCAAATCCAACAAGAG
ATGTACTTAGGTGAGCGGGATCGTCGCAAGATTGTGTTCATTGACGAAGCCTGGGATCTGCTGACTCAAG
GTGATGTCGGTAAGTTCATCGAAACCGGTTACCGTCGATTTCGAAAATATGGCGGCAGTGCTGTAACAGT
AACGCAGTCGGTCAACGATTTATACGACAGCCCTACAGGTAAAGCCATCGCTGAAAACTCGGCCAATATG
TACCTGCTTGGCCAAAAAGCCGAAACCATCAACGCGCTCAAAAAAGAAGGCCGTTTGCCATTAGGTGAAG
GCGGCTACGAATACCTGAAAACGGTTCATACCGTCACGGGTGTCTATTCCGAGATTTTCTTTATTACCGA
GATGGGCACCGGGATTGGCCGCCTTATCGTCGATCCGTTTCACAAGCTGTTGTACTCGTCCCGTGCAGAA
GATGTAAACGCGATTAAGCAGTTAACGCGCAAAGGCCTTTCTGTTGCTGATGCCATCTCCCAGTTGTTAA
AGGAGCGAGGCTATGAATAA
 Primer design