SecReT4
Protein ID: 197286312
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2466
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2694791..2695441 [-]
Productplasmid-like protein
Component typeTraV_F
UniProt IDB4EWT3
KEGG IDpmr:PMI2466
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.6e-20, Aligned region: 67..173
Protein Sequence: 216 a.a.     [Download]
>gi|197286312|ref|YP_002152184.1| plasmid-like protein [Proteus mirabilis HI4320]
MKKSCMLLTDRSPFQTIRCVSRGELTMTTSMQNNPKHQSKQWSKAGLLLLAVGSTLLSGCSSLGLGSSEY
GCPGMPDGVRCLSAREVYELTSNGAAPKTIDAVATRIGSPSGYSQSDLETGLLSHPALPETQQSAPIRIP
SRVMRIWIAPWEDDRGDLNLSSYVFTEIEPRRWDIGVSAPRTVSPVLRPLQTQSDSASAGADGKRDNLSI
YGETNE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2695441-2694791 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAAAATCCTGCATGTTGCTAACCGATCGAAGTCCGTTTCAGACAATAAGATGTGTATCCAGAGGAG
AGTTAACCATGACGACATCAATGCAGAACAACCCAAAGCACCAGTCAAAACAGTGGTCTAAAGCTGGATT
ACTTTTATTGGCAGTCGGCTCAACCTTATTGTCTGGCTGTAGTTCATTGGGTCTTGGGAGTAGTGAATAT
GGATGCCCAGGTATGCCTGACGGTGTGCGCTGTTTATCCGCGCGTGAAGTCTATGAGCTTACCAGTAATG
GCGCTGCACCCAAGACGATTGATGCTGTGGCGACTCGAATTGGTTCTCCCTCTGGGTATTCACAATCTGA
TTTAGAAACAGGACTGTTGAGCCATCCAGCATTACCTGAGACGCAGCAATCTGCACCTATTCGCATTCCT
TCAAGGGTGATGCGAATTTGGATTGCGCCTTGGGAGGATGACCGTGGAGATCTGAATTTATCCAGCTACG
TGTTTACCGAAATTGAACCGCGCCGGTGGGATATTGGGGTGTCAGCACCTCGAACGGTTTCGCCAGTGCT
ACGTCCACTTCAGACTCAAAGCGATTCTGCCTCAGCGGGAGCTGATGGTAAGCGCGATAACTTGAGTATC
TACGGAGAAACTAACGAATGA
 Primer design