SecReT4
Protein ID: 197286313
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2467
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2695438..2696727 [-]
Productplasmid pilus assembly protein
Component typeTraB_F
UniProt IDB4EWT4
KEGG IDpmr:PMI2467
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.2e-51, Aligned region: 212..416
Protein Sequence: 429 a.a.     [Download]
>gi|197286313|ref|YP_002152185.1| plasmid pilus assembly protein [Proteus mirabilis HI4320]
MKAQWEQMSPNMKRGLSVAGIAGGLILMVMVFSPNPDDGSSSRNRQETIRHILTDTNTRDVGVDSLAANV
KLLSERNEQLRREVERLRRDVDSGRLSPGSPSIPSEVNAELARLRAELDDVRAGGDAAVEGTNSRFEVPL
SAMELPKEERPLPSNPDDYFANAPLPDPLYQQPANGQGTRARDVPLPPITIRMIEPEVVAEPEVVVQEAP
PLYLPAGSIISGTLITGLDAPTHESARREPFPALLRIQKEAILPNRFRADIKECFLIAAGYGDLSSERAY
LRGETISCVREDGGVIETRLDSYAVGEDGKAGIRGRLVSKQGQLVAKSMMAGFLQGLAGAFDVNPVPTIQ
TGNAGDTQLYQQVMSQEALQGAAIKGTGKALDRVAKFYLDMAENMFPVIEVDAARKIEVIVTRGASLSLA
TSQGVGARR
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2696727-2695438 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAGCACAATGGGAGCAAATGAGCCCGAACATGAAGCGGGGTCTATCGGTTGCTGGTATTGCTGGTG
GTCTCATCCTTATGGTGATGGTGTTTTCACCTAATCCTGACGATGGCTCAAGCAGTCGTAACCGGCAGGA
AACGATCCGGCACATTCTTACGGATACCAATACTCGTGATGTTGGGGTCGATAGTTTGGCTGCGAACGTA
AAACTACTCAGTGAGCGCAATGAACAGTTACGTCGTGAAGTTGAGCGCTTGCGTCGTGACGTCGATTCAG
GACGGCTAAGCCCAGGTTCGCCTTCTATACCAAGTGAGGTCAATGCGGAGTTGGCTCGCCTTCGAGCGGA
ACTTGATGATGTTCGCGCTGGAGGTGATGCAGCTGTTGAAGGCACAAATAGCCGTTTCGAAGTGCCTTTA
TCTGCCATGGAATTGCCTAAAGAAGAAAGGCCACTGCCGTCTAACCCAGACGACTATTTTGCCAATGCGC
CGCTGCCTGATCCGCTCTATCAGCAGCCAGCCAATGGCCAAGGTACACGAGCACGAGATGTTCCATTGCC
GCCAATCACGATTCGTATGATTGAGCCTGAAGTGGTTGCTGAACCAGAGGTTGTTGTGCAAGAAGCGCCG
CCTTTGTATCTACCGGCGGGCAGCATCATCTCAGGTACTTTGATCACCGGTTTGGATGCACCTACTCACG
AGTCCGCAAGACGTGAACCTTTTCCTGCATTGCTGAGGATTCAAAAGGAAGCCATTTTACCCAACCGATT
TAGAGCGGATATCAAAGAGTGTTTCTTGATCGCCGCAGGTTACGGTGATTTGAGCTCTGAGCGTGCTTAT
TTGCGAGGCGAGACCATTTCATGTGTGAGAGAAGATGGTGGCGTCATTGAAACGCGACTGGATTCTTATG
CCGTGGGTGAAGACGGCAAAGCCGGTATTCGTGGCCGATTAGTGTCGAAACAAGGCCAGCTGGTGGCCAA
ATCGATGATGGCCGGATTCCTTCAGGGCTTGGCTGGCGCATTTGATGTGAATCCTGTACCAACGATTCAG
ACGGGTAATGCCGGTGATACTCAGCTGTACCAGCAAGTCATGAGCCAAGAAGCATTACAAGGCGCTGCGA
TTAAAGGCACAGGTAAAGCATTGGATCGAGTGGCCAAGTTCTATTTGGACATGGCTGAAAATATGTTCCC
AGTCATAGAGGTAGACGCTGCAAGGAAAATTGAAGTCATAGTCACTCGTGGGGCCTCGTTGTCGTTGGCC
ACTTCACAAGGTGTAGGTGCAAGAAGATGA
 Primer design