SecReT4
Protein ID: 197286314
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2468
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2696730..2697629 [-]
Productplasmid-like protein
Component typeTraK_F
UniProt IDB4EWT5
KEGG IDpmr:PMI2468
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.4e-17, Aligned region: 46..277
Protein Sequence: 299 a.a.     [Download]
>gi|197286314|ref|YP_002152186.1| plasmid-like protein [Proteus mirabilis HI4320]
MMRTKISRWMTPSLIAISLSGVLLSQASYADVELPIVPASVMKQSATANPPTQTNTASTDVPTTLLMTPG
INELIPVALGHLNRIVTPFESPQVRTTSDAQTQIKGNVVYVATDKESPVSLYITPPGQEAPALSVTLVPR
RIPPREITLAIDGQQWPIKGVVNRKAATWETAQPYVDNLRDLLRRLALNELPQGYDIRLAGQTDTSPKCF
QPGLKFGFKQGQIVSGHYFTVYVGLVESFADEPIEASELACHAPDIVASAYWPRNILLPGEKTELYVVVR
NHREEAVESQRPSLLVGGE
 
Nucleotide Sequence: 900 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2697629-2696730 Proteus mirabilis HI4320 chromosome, complete genome
ATGATGCGAACCAAAATTAGTCGATGGATGACACCAAGCTTAATCGCAATTAGCTTGAGTGGCGTCCTGT
TATCACAAGCGTCGTATGCAGACGTGGAATTGCCGATTGTGCCAGCCAGTGTGATGAAGCAGTCTGCTAC
TGCAAATCCACCGACTCAAACCAATACGGCTTCAACGGATGTGCCAACAACGCTGCTGATGACACCGGGG
ATTAATGAACTGATCCCTGTAGCACTTGGCCATCTGAACCGGATTGTGACGCCGTTTGAATCGCCTCAGG
TAAGAACAACCAGTGATGCTCAGACGCAAATCAAGGGGAATGTTGTATATGTGGCCACGGACAAAGAATC
ACCGGTTTCACTTTACATCACTCCGCCTGGTCAGGAAGCGCCCGCATTATCAGTCACCTTAGTACCTCGT
CGTATTCCACCGCGTGAAATCACCTTAGCTATTGATGGTCAGCAGTGGCCTATTAAGGGCGTCGTGAACC
GAAAAGCCGCCACTTGGGAAACGGCTCAGCCATACGTCGATAACCTACGTGACTTACTCAGACGCCTTGC
ACTAAATGAGTTACCACAAGGCTATGACATCCGTTTAGCTGGCCAAACTGACACAAGCCCGAAATGTTTT
CAGCCGGGCTTAAAGTTTGGTTTTAAGCAGGGGCAAATTGTGTCGGGACATTACTTCACCGTCTATGTAG
GACTGGTTGAAAGCTTTGCCGATGAGCCGATAGAAGCCAGTGAATTAGCCTGTCATGCACCAGATATAGT
GGCAAGTGCTTACTGGCCACGCAATATCTTGTTGCCGGGTGAAAAGACTGAGTTGTATGTGGTTGTTCGC
AATCATCGTGAAGAAGCGGTGGAAAGTCAGCGACCTTCGCTTCTTGTGGGAGGTGAATAA
 Primer design