SecReT4
Protein ID: 197286315
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2469
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2697610..2698236 [-]
Productplasmid pilus assembly protein
Component typeTraE_F
UniProt IDB4EWT6
KEGG IDpmr:PMI2469
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.4e-16, Aligned region: 22..175
Protein Sequence: 208 a.a.     [Download]
>gi|197286315|ref|YP_002152187.1| plasmid pilus assembly protein [Proteus mirabilis HI4320]
MKFDVFLKSWQGTQLENRWQRFLIAVLVLSNLLLAVAAFSRNTVVAIQPPTLSETAEVSRNQATQPYLES
WGLYLAELMGNVTPGNVSFIRVAIEPLLSPAVYQQVVDALEIQARQIREDRVTLKFQPRQVEYEYETGHV
FVTGYSLVSGPSGDEQRQTRTYEFDIDIEQYRPKLSWMDTYEGQARTKRVREKLTQEQNRRVNDANQN
 
Nucleotide Sequence: 627 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2698236-2697610 Proteus mirabilis HI4320 chromosome, complete genome
GTGAAGTTCGACGTGTTTTTAAAATCATGGCAAGGCACGCAATTAGAGAACCGATGGCAACGGTTCCTGA
TTGCGGTGCTGGTGCTATCTAACTTGCTGCTTGCGGTAGCGGCATTTTCTCGCAATACCGTGGTGGCCAT
TCAACCACCAACCTTGTCTGAAACGGCTGAAGTGTCACGAAACCAGGCCACTCAGCCTTACCTGGAATCT
TGGGGACTCTACCTGGCTGAGCTTATGGGCAACGTGACGCCGGGCAATGTGTCCTTTATCCGGGTTGCTA
TCGAGCCGCTACTTTCACCTGCGGTGTACCAGCAAGTGGTCGATGCACTGGAGATTCAGGCAAGACAGAT
CCGTGAAGACCGAGTCACGCTCAAATTCCAACCCAGACAAGTGGAGTATGAGTATGAAACCGGCCATGTC
TTTGTGACCGGTTATTCCTTGGTCTCTGGACCATCTGGAGATGAGCAGCGCCAAACTCGCACCTATGAGT
TTGATATCGATATTGAGCAATACCGTCCAAAACTTAGCTGGATGGATACGTATGAAGGGCAAGCTAGAAC
GAAGCGAGTTCGTGAAAAGTTGACCCAAGAGCAAAACCGGAGGGTGAATGATGCGAACCAAAATTAG
 Primer design