SecReT4
Protein ID: 197286316
T4SS name [ID]Tra_F [584]
Gene symbol-
Locus tagPMI2470
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2698233..2698514 [-]
Productplasmid pilus assembly protein
Component typeTraL_F
UniProt IDB4EWT7
KEGG IDpmr:PMI2470
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-16, Aligned region: 4..92
Protein Sequence: 93 a.a.     [Download]
>gi|197286316|ref|YP_002152188.1| plasmid pilus assembly protein [Proteus mirabilis HI4320]
MEPVSIPSYIDDPPHFLLWSADEMAPILLGLVIGIFTGNALVLCLLGLVTTKLYRRFRDGRPDGFILHAI
YWAGLLPTKAKTIPNPFIRSYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2698514-2698233 Proteus mirabilis HI4320 chromosome, complete genome
ATGGAACCTGTGAGTATTCCGTCCTATATCGATGACCCGCCGCACTTCCTGCTTTGGAGTGCCGATGAGA
TGGCTCCCATTCTGTTGGGGCTAGTGATCGGCATTTTTACCGGTAATGCCTTGGTTTTATGCCTGTTGGG
GTTGGTGACAACCAAGCTCTATCGGCGTTTTCGTGATGGTCGCCCAGATGGTTTTATTCTTCACGCCATC
TACTGGGCCGGGCTGTTGCCAACCAAAGCCAAGACAATCCCTAACCCATTTATCAGGAGCTATCTGCCGT
GA
 Primer design