SecReT4
Protein ID: 197286419
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2572
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2809018..2810457 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDB4EXH1
KEGG IDpmr:PMI2572
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 479 a.a.     [Download]
>gi|197286419|ref|YP_002152291.1| hypothetical protein PMI2572 [Proteus mirabilis HI4320]
MKAKRHTFFPPALTLMVLCSVPAFSVRAGLDFSAGANDIGYGANVSGAVSDKLYYNLGGGTVLSQPPGRS
NLQRLGMSMGWNSDLMCGNFDIKTTVGNQLNGVTAGFKNLMSEVIQNATGAVASLPAMAIQRANPGLYEM
LTNGVLQANVAFDKAQLNCQNMAKRMMDFSENNQWTQAAILEEAKNIINNSDGDAVKTDQQIQQSSGDKG
VVWIGGKQRGGVGQPAIQPAQDFAQAGFNIMNGLPATSTAPVPAGQCNGAACRRFANSEEAAQVVTQVLG
SKSVRTCTNPADCQSGGEAEQPGSSQPGTGLAPVLETTTRENLEQLHKLVNSRGAVGAAELAKLKTGSLT
VSRGVIEALRRDPDKTALTQRLAGELAMADTMELALTMRRMLITGQGEPNAGNFPKAQEIGNQSVDQLDR
EIGMLQTEMEVRKSIANNAMLTVIERDQQRTQANPATQTPDNTDVRVQGLEQNSDTGGR
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2810457-2809018 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAGCAAAACGACACACGTTTTTTCCGCCGGCGCTGACACTGATGGTGTTATGCAGTGTACCGGCAT
TTTCTGTCCGGGCCGGGCTGGATTTTTCTGCCGGTGCGAATGATATCGGCTACGGCGCAAATGTTTCCGG
CGCGGTCTCCGACAAACTGTACTACAACCTGGGCGGCGGCACGGTGTTATCCCAGCCGCCGGGGCGCAGT
AATCTGCAACGTCTGGGGATGAGCATGGGCTGGAACAGTGATCTGATGTGCGGCAATTTTGATATCAAAA
CCACGGTGGGCAACCAGCTGAACGGGGTGACGGCCGGCTTTAAGAATCTGATGAGTGAGGTGATCCAGAA
TGCCACCGGGGCGGTGGCCAGTCTGCCGGCGATGGCTATCCAGCGGGCGAATCCCGGCCTGTATGAAATG
CTGACCAACGGGGTGTTGCAGGCTAATGTGGCGTTTGATAAGGCGCAGCTGAACTGTCAGAACATGGCTA
AACGGATGATGGACTTTTCAGAAAATAATCAGTGGACGCAGGCGGCGATCCTCGAAGAAGCAAAGAATAT
CATCAATAACAGTGACGGGGATGCGGTAAAAACTGACCAGCAAATTCAGCAAAGCAGTGGCGATAAAGGG
GTTGTATGGATAGGCGGGAAACAGCGCGGTGGGGTTGGTCAGCCTGCGATTCAGCCGGCGCAGGATTTTG
CACAGGCCGGCTTTAATATCATGAACGGTCTGCCGGCAACCAGTACGGCCCCGGTGCCGGCCGGCCAGTG
TAACGGAGCCGCTTGCAGGCGCTTTGCCAACAGTGAGGAAGCCGCTCAGGTGGTCACACAGGTGCTGGGC
AGCAAATCGGTCCGCACCTGCACCAATCCGGCGGATTGTCAGAGCGGCGGTGAGGCGGAGCAACCGGGCA
GTTCCCAGCCAGGAACCGGGCTGGCACCGGTGCTGGAGACCACCACCCGGGAAAATTTGGAACAGCTGCA
TAAACTGGTGAACAGCCGGGGCGCGGTCGGGGCGGCAGAGTTGGCGAAACTGAAAACCGGCAGCCTGACG
GTCTCCCGGGGGGTGATTGAAGCGCTGCGCCGGGATCCGGATAAAACGGCATTAACACAGCGTCTGGCCG
GTGAGCTGGCGATGGCGGACACGATGGAGCTGGCGCTGACGATGCGCCGGATGCTGATCACCGGCCAGGG
GGAGCCGAATGCCGGTAATTTTCCGAAAGCCCAGGAGATCGGTAACCAGTCGGTTGACCAGCTGGATCGC
GAAATCGGGATGCTGCAAACGGAAATGGAAGTGCGTAAATCCATTGCCAATAACGCGATGCTGACGGTGA
TTGAGCGTGATCAGCAACGGACACAGGCGAACCCTGCCACCCAGACCCCAGATAATACGGATGTGCGTGT
ACAGGGACTGGAGCAAAACAGTGACACCGGAGGACGTTAA
 Primer design