SecReT4
Protein ID: 197286429
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2582
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2821091..2821507 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDB4EXI1
KEGG IDpmr:PMI2582
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.4e-39, Aligned region: 1..124
Protein Sequence: 138 a.a.     [Download]
>gi|197286429|ref|YP_002152301.1| hypothetical protein PMI2582 [Proteus mirabilis HI4320]
MQTIDFMPDRLNAEPTVFRGFTTHEMFAAAGVGCVGGSVISIPLLPLAGWVILPTGALIMPLLVVFFGGT
FLTRIKRGKPENYLYRRLSWKLQTGFARTLPLTGRLTEKSLITVSQGWFLRRTQALSLCRYIAGGRHE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2821507-2821091 Proteus mirabilis HI4320 chromosome, complete genome
ATGCAGACCATCGATTTTATGCCGGATCGCTTAAATGCAGAGCCCACCGTCTTTCGCGGATTTACCACCC
ATGAAATGTTTGCCGCCGCCGGTGTCGGTTGTGTGGGCGGGAGCGTTATCAGTATCCCGCTGTTACCGCT
GGCCGGGTGGGTGATCCTGCCGACCGGCGCGTTGATAATGCCGCTGTTGGTGGTGTTTTTTGGCGGCACT
TTTCTGACCCGTATCAAACGCGGAAAACCGGAAAATTATCTCTACCGCCGATTGTCCTGGAAACTGCAAA
CCGGGTTTGCCCGCACATTGCCGCTGACCGGACGGCTGACTGAAAAATCCCTCATCACCGTATCTCAGGG
CTGGTTTTTACGCCGGACGCAGGCGCTGTCACTGTGCCGGTATATCGCCGGAGGCCGCCATGAGTAA
 Primer design