SecReT4
Protein ID: 197286432
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2585
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2822166..2822492 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDB4EXI4
KEGG IDpmr:PMI2585
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.8e-27, Aligned region: 22..103
Protein Sequence: 108 a.a.     [Download]
>gi|197286432|ref|YP_002152304.1| hypothetical protein PMI2585 [Proteus mirabilis HI4320]
MRLFSPLISLFALVVSAFGVLPAQAAEKDELALTLKQLDHIQASLERARIQANQDNHARFYFDYSRASRE
VEIIRQGIVRYLEPSRAQPTVPVNVAEPLRGDYRREQR
 
Nucleotide Sequence: 327 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2822492-2822166 Proteus mirabilis HI4320 chromosome, complete genome
ATGCGATTATTTTCTCCGCTTATTTCCCTGTTTGCGTTGGTTGTCAGTGCATTTGGGGTATTGCCTGCTC
AGGCCGCTGAAAAAGATGAACTGGCGCTGACGTTAAAGCAGCTCGATCACATCCAGGCCAGCCTGGAGCG
CGCCCGTATTCAGGCAAATCAGGACAATCACGCCCGTTTTTATTTTGATTATTCCCGCGCCTCCAGAGAG
GTGGAGATTATCCGGCAGGGGATTGTCCGCTATCTGGAGCCTTCCCGGGCCCAGCCCACGGTGCCGGTTA
ATGTGGCGGAGCCGCTGCGCGGGGATTACCGCCGGGAGCAGCGATGA
 Primer design