SecReT4
Protein ID: 197286434
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2587
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2823335..2824084 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDB4EXI6
KEGG IDpmr:PMI2587
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.6e-74, Aligned region: 49..246
Protein Sequence: 249 a.a.     [Download]
>gi|197286434|ref|YP_002152306.1| hypothetical protein PMI2587 [Proteus mirabilis HI4320]
MATAEVRQETPRHPAKDPGLPAKLLWHWPWAIIGVLLASWVCSLLIEWVGIAFFWADEGAEHSRQVMLTE
SGYLSEGFTRSLLMSSPAQWLAHTVEQAYRWLFVESGLMESWQNVYPVSGNAVARELDDWRIWFVSELRD
YLLATVYVTLTFFIRVTILVLSMPLFVMVLLVGMVEGFNRRDLRRYGAGYESSFVYHHAKRFVKPAFFVP
CMIYLSWPSAIYPNLVLLPAALLFGLAVAVATASFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2824084-2823335 Proteus mirabilis HI4320 chromosome, complete genome
ATGGCAACTGCTGAGGTACGTCAGGAAACCCCGCGTCACCCGGCAAAAGACCCCGGTTTGCCGGCTAAAT
TGTTGTGGCACTGGCCGTGGGCCATCATCGGGGTATTACTGGCCTCCTGGGTATGCAGTCTGTTGATTGA
GTGGGTCGGGATTGCGTTTTTCTGGGCGGACGAAGGGGCGGAGCACAGCCGGCAGGTGATGTTAACCGAG
AGCGGGTATCTGTCAGAAGGGTTTACCCGTAGTCTGCTGATGTCCAGTCCGGCGCAGTGGCTGGCTCATA
CCGTTGAACAGGCATACCGGTGGCTGTTTGTGGAGTCCGGGCTGATGGAGAGCTGGCAGAACGTGTATCC
TGTCAGCGGGAATGCAGTTGCCCGTGAACTGGATGACTGGCGGATTTGGTTTGTGTCCGAGCTGAGAGAC
TATCTGCTGGCGACGGTTTATGTGACGCTGACCTTTTTTATCCGGGTGACTATTCTGGTGCTGTCGATGC
CCCTGTTTGTTATGGTGCTGTTGGTGGGCATGGTGGAAGGCTTTAACCGGCGTGATTTGCGGCGTTATGG
TGCCGGGTATGAATCCAGTTTTGTGTATCACCACGCCAAGCGTTTTGTTAAGCCGGCCTTTTTTGTTCCG
TGCATGATTTATCTGTCCTGGCCGTCTGCCATTTACCCTAATCTGGTGTTGTTACCGGCGGCTCTGTTGT
TCGGGCTTGCGGTGGCAGTGGCTACCGCGTCATTTAAAAAATATTTATAG
 Primer design