SecReT4
Protein ID: 197286438
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2591
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2827118..2827756 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDB4EXJ0
KEGG IDpmr:PMI2591
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 212 a.a.     [Download]
>gi|197286438|ref|YP_002152310.1| lytic transglycosylase [Proteus mirabilis HI4320]
MRKNSLLTLVLLLFSVPLPAREVPPGYREVARQENVPAEALYSLALTESSWTLPAHHPQAGEIHPWPWTL
NVAGKGYRYPTRQAAWQALQSFLQTTSPRRIDVGIAQVNWGWNGHHFRSAWEAFDPYTNLHVAARILRRC
YEASPGSWIRAAGCYHHPAGGQPAVRYKNSVRRQLATLTGGTQPVPAHLPAVSTDRAVSFVWIEPENKTD
AK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2827756-2827118 Proteus mirabilis HI4320 chromosome, complete genome
ATGCGTAAAAATTCCCTGCTCACTCTTGTCCTGCTGCTGTTTTCCGTGCCGTTACCGGCTCGGGAGGTGC
CGCCGGGCTACCGTGAGGTGGCCCGGCAGGAGAATGTACCAGCAGAAGCCCTGTATTCCCTGGCACTGAC
GGAGTCATCCTGGACATTACCGGCACATCACCCGCAGGCCGGTGAAATCCATCCCTGGCCGTGGACGCTG
AATGTGGCTGGTAAAGGATACCGTTATCCGACACGGCAGGCCGCCTGGCAGGCTTTACAGTCGTTTTTAC
AGACGACATCCCCCAGACGTATTGATGTGGGGATTGCACAGGTGAACTGGGGCTGGAACGGGCATCACTT
CCGTTCCGCCTGGGAGGCCTTTGATCCTTATACCAATTTGCATGTGGCCGCCCGCATCCTGCGCCGCTGT
TATGAGGCGTCACCGGGTAGTTGGATCCGTGCCGCCGGCTGTTATCACCATCCGGCGGGCGGTCAGCCCG
CAGTACGCTATAAAAATAGTGTCCGGCGTCAGCTGGCGACACTGACGGGCGGTACACAACCCGTTCCCGC
TCATTTACCGGCAGTCAGTACAGATCGGGCTGTATCGTTTGTGTGGATAGAACCGGAGAACAAAACCGAT
GCGAAATAA
 Primer design