SecReT4
Protein ID: 198241662
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0095
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]55108..56313 [-]
Productpilx10 protein
Component typeVirB10
UniProt IDB5FH93
KEGG IDsed:SeD_B0095
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-48, Aligned region: 208..390
Protein Sequence: 401 a.a.     [Download]
>gi|198241662|ref|YP_002213925.1| pilx10 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MTEQENKIPTATEIEQQLRERRQKELEQAGKTPEEEPGKPALQLGIEKLKKSRKGMIILVVGFLLLAAGV
SVYYIPSIIRSVSSGDEKPASQPLATGAAKRQTGLSEDIDPFNTAQKKTEKPEEEKVISSEKTEPPENKQ
QSFSRALDVSLDGSQAGNSSSSAGTSVSHTAASEPESDKKDEAKATAQATESAPLAKITKLPYDPNLFIP
EGTSIPCSLDRRFVSDLAGKLECTVNSDIYSASGNVKLIERGTAAKLMYKAGSLNHGQGRVFVMAYKLRT
RSKPFIDIPLVDSQAAGALGEAGASGWIDTHFSERFLGAMMVGMIPDLSQAASGIAQNNRDSQTDYTANS
RQAFADIAREAFSNSVNIPPTLYKNQGEIITLIVGQDLDFSGIYKLKMKGG
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c56313-55108 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
GTGACTGAACAGGAAAATAAAATCCCGACTGCAACCGAAATTGAACAGCAGCTACGGGAACGCAGACAGA
AAGAACTGGAACAGGCCGGGAAGACTCCGGAAGAAGAGCCTGGCAAGCCAGCATTGCAGCTTGGTATTGA
AAAACTTAAAAAGTCACGTAAAGGGATGATTATCCTCGTCGTGGGTTTTCTTCTGCTTGCTGCCGGTGTT
TCTGTTTATTATATCCCGTCCATTATCCGTTCTGTGTCGTCAGGGGATGAGAAACCCGCAAGTCAGCCGC
TTGCAACCGGAGCGGCTAAACGTCAGACCGGACTGAGCGAAGATATCGATCCTTTTAATACCGCACAGAA
AAAAACAGAGAAACCAGAGGAAGAAAAAGTCATTTCTTCTGAAAAGACTGAACCGCCGGAAAATAAACAG
CAGAGCTTCAGCCGTGCACTTGATGTTTCTCTTGATGGCAGCCAGGCAGGAAACAGCAGCAGTTCAGCGG
GAACGTCAGTTTCACATACTGCGGCCAGTGAGCCAGAAAGCGATAAAAAGGATGAAGCAAAAGCAACCGC
ACAGGCTACAGAATCTGCGCCACTGGCGAAAATAACGAAACTTCCATATGACCCAAATTTGTTTATCCCG
GAAGGGACATCAATTCCCTGTTCACTGGACAGGCGTTTTGTTTCTGACCTGGCGGGGAAACTGGAATGTA
CGGTCAACAGCGATATATACAGCGCCAGCGGTAATGTAAAACTTATCGAAAGAGGAACCGCCGCAAAACT
GATGTATAAGGCCGGGTCTTTAAATCATGGACAAGGGCGTGTGTTTGTTATGGCTTACAAGCTACGTACT
CGCAGTAAGCCTTTTATTGATATTCCCCTGGTTGACTCACAGGCGGCTGGCGCGTTAGGCGAAGCCGGTG
CTTCTGGTTGGATTGACACTCATTTCAGTGAACGTTTTCTTGGTGCAATGATGGTCGGGATGATACCGGA
TTTAAGTCAGGCCGCCAGTGGTATTGCACAGAACAACAGGGACAGCCAGACCGACTATACGGCAAACAGT
CGCCAGGCTTTTGCTGATATAGCACGCGAAGCATTTTCTAATAGTGTGAATATTCCGCCAACGCTTTATA
AAAATCAGGGCGAAATTATTACTCTGATTGTCGGTCAGGATCTGGATTTTTCAGGTATTTATAAACTGAA
AATGAAAGGGGGTTAA
 Primer design