SecReT4
Protein ID: 198241677
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0104
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]63388..64035 [-]
Productpilx1 protein
Component typeVirB1
UniProt IDB5FGZ9
KEGG IDsed:SeD_B0104
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.6e-19, Aligned region: 9..139
Protein Sequence: 215 a.a.     [Download]
>gi|198241677|ref|YP_002213934.1| pilx1 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MLSTSTFLALAMQCAASVHPDTTHEVARVESGFNPYAIAEIIPKVKRKPGDKGVVSYFPESKEAALKIVK
NIELRNHRYSVGLMQITSTNFAKFGTTAEKMFDPCENLKVSEKILVDCYKRGGDLVRGLSCYYSGNPETG
VKPEPEFNNTSYVQRIGFSPPDNKKIFIVPSVKEMIKKENKTTITPEEIIIYPQYAMRGTVSNEKETKDV
EIKSE
 
Nucleotide Sequence: 648 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c64035-63388 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGTTATCTACTTCTACTTTTCTTGCGCTTGCCATGCAATGCGCTGCCAGCGTTCATCCTGACACAACGC
ACGAAGTCGCCAGGGTTGAATCAGGTTTTAACCCATATGCGATTGCGGAAATAATACCAAAGGTTAAACG
CAAACCTGGTGATAAAGGCGTAGTATCTTACTTTCCAGAATCAAAGGAGGCAGCACTTAAGATCGTTAAA
AACATTGAATTACGGAATCATCGTTACTCTGTAGGACTTATGCAAATAACAAGTACCAATTTTGCAAAGT
TCGGCACAACAGCAGAGAAAATGTTTGATCCATGCGAAAATCTTAAGGTATCAGAAAAAATACTGGTTGA
CTGTTATAAACGAGGTGGCGACTTAGTGCGTGGTCTGAGTTGCTATTATTCCGGCAATCCAGAAACAGGA
GTAAAGCCAGAACCTGAATTTAATAATACAAGTTATGTACAACGTATAGGATTTAGCCCTCCTGATAATA
AAAAAATTTTTATTGTTCCCTCTGTAAAGGAAATGATTAAAAAGGAGAATAAGACGACTATCACACCTGA
AGAAATCATTATATATCCTCAATACGCCATGCGTGGCACTGTATCAAATGAAAAGGAAACAAAAGATGTT
GAAATTAAATCTGAATAA
 Primer design