SecReT4
Protein ID: 198241689
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0103
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]63114..63410 [-]
Productpilx2 protein
Component typeVirB2
UniProt IDB5FGZ8
KEGG IDsed:SeD_B0103
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-21, Aligned region: 3..97
Protein Sequence: 98 a.a.     [Download]
>gi|198241689|ref|YP_002213933.1| pilx2 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MLKLNLNKRYLTLSLFMAALMLCVAEPAFADDVSTKTTGFLQKIIDFLTDIRKPAITIIALVIGYIAIFS
RQHTSWIVPLVIGIIIFIVAPYIPDWLA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c63410-63114 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGTTGAAATTAAATCTGAATAAACGTTATTTAACGCTTTCTCTATTTATGGCTGCGTTGATGCTTTGTG
TTGCAGAACCTGCTTTTGCGGATGATGTGTCTACGAAGACAACTGGTTTTTTACAGAAAATAATTGATTT
TTTAACGGATATTCGTAAACCTGCAATTACAATTATTGCTCTTGTTATTGGATATATTGCGATATTTTCT
CGTCAACATACCTCATGGATAGTCCCACTTGTTATCGGAATTATCATCTTTATTGTTGCACCATATATTC
CTGACTGGCTTGCGTAA
 Primer design