SecReT4
Protein ID: 198241710
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0101
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]59573..60331 [-]
Productpilx5 protein
Component typeVirB5
UniProt IDB5FGZ6
KEGG IDsed:SeD_B0101
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.3e-23, Aligned region: 22..215
Protein Sequence: 252 a.a.     [Download]
>gi|198241710|ref|YP_002213931.1| pilx5 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MKKQIMAAFVASLIVISGAQAGIPVAIDANPEWAIEAGRWTERLKQWAETVKHYENQINAYKQELLSKTG
IRDVQGLVQSAQSVSKELMQIYDQGNAFIDDYIKNPESALSEQAKSLLSDYRVTDTCHNLGYSGDLVRGC
EATFLSQLASVEYGNKLESKLRQDNQTMKDLIDQVKNAKDTKATQDATNAVALEQLKFEKLKFQYQMYRD
KQRDLAEYKEKMAQASFRKQQREAVPPSYRKAYMAMKSYEDD
 
Nucleotide Sequence: 759 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c60331-59573 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGAAAAAGCAAATTATGGCGGCATTCGTCGCTTCACTGATTGTTATTTCCGGCGCTCAGGCAGGGATAC
CTGTTGCCATCGACGCCAACCCTGAATGGGCGATTGAAGCCGGACGATGGACAGAACGCCTTAAGCAATG
GGCAGAAACGGTGAAACATTACGAAAATCAGATAAATGCGTACAAACAGGAGCTGCTGTCAAAAACGGGT
ATCCGTGATGTGCAGGGACTGGTGCAGTCCGCACAGTCAGTGAGTAAGGAGCTGATGCAGATTTATGATC
AGGGGAATGCTTTTATTGACGATTACATTAAAAATCCTGAAAGTGCGTTATCGGAACAGGCCAAATCGTT
ATTGTCAGATTACAGGGTAACAGATACCTGTCATAACCTGGGATATTCCGGTGACCTGGTACGGGGATGT
GAAGCGACGTTCCTTTCTCAACTGGCAAGCGTGGAATACGGTAACAAGCTGGAGAGCAAGCTTCGTCAGG
ACAACCAGACGATGAAAGACCTTATTGATCAAGTCAAAAATGCGAAGGATACGAAGGCCACGCAGGATGC
AACAAACGCTGTTGCACTTGAACAACTGAAGTTCGAGAAGCTCAAATTTCAGTATCAAATGTATCGCGAT
AAGCAACGAGATCTTGCAGAATATAAAGAGAAGATGGCTCAGGCTTCTTTCAGAAAACAGCAACGTGAAG
CCGTGCCTCCTTCTTACAGAAAAGCTTATATGGCAATGAAATCATATGAGGATGATTAA
 Primer design