SecReT4
Protein ID: 198241712
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0102
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]60342..62972 [-]
Productpilx4 protein
Component typeVirB4
UniProt IDB5FGZ7
KEGG IDsed:SeD_B0102
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.1e-46, Aligned region: 231..433
AAA_10 [PF12846], Evalue: 4.3e-29, Aligned region: 498..784
VirB3 [PF05101], Evalue: 1.9e-05, Aligned region: 1..43
Protein Sequence: 876 a.a.     [Download]
>gi|198241712|ref|YP_002213932.1| pilx4 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MYALILPGWYAIRRVTQFDERFFDLLYLRTLVKGHPLSNKRFSAVHYAGSQYDEVDISKVDNFMKLKDQS
SVEELIPYSSHITDNIIVTKNRDLLATWQIDGAYFECVDSEDLSILTDQLNTLIRSFEGKSVTLYPHRIR
CKKDVRPVFNSKIPFVNRVMNDYYESFPQSEFFENKLFLTICFKPFTTEDKVTHFFSRSKKQKDIFKEPV
NEMNEICDRLNTYLSRFHSRRLGLYEDHGVVYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGN
DAGQITASDHARYFRCIEIKDYFQETDAGILDALMYLPVEYVVTSSFTAMDKQSAIKALDDQIDKLEMTD
DAAKSLLADLKVGLDMVSSGYISFGKSHQTLVVFADSPERLVKDTNIVTSTLEDLGLIVTYSTLSLGAAY
FAQLPGNYTLRPRLSTLSSLNFAEMESFHNFFSGKEKGNTWGEKLITLRGSGNDIYHLNYHMTTEHQNFF
GKNPTLGNTEILGTSNVGKTVLLMTKAFAAQQFGTPESFPANRKLKKLTTVFFDKDRAGEVGIRAMGGSY
YRVKEGEPTGWNPAALPPTKRNIAFMKDLVRLLCTLNSEPLDDYQNSLISDAVERLMQRSDRSYPISKLR
PLIQEPDDTETKRHGLKARLKPWTQGEEFGWVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASAASFYLI
YRVTMLADGRRLLIYMDEFWQWINNEAFRDFVYNKLKTGRKLDMVLVVATQSPDELIKSPIAAAVREQCA
THIYLANPKAKRSEYVDGLQVRELYFDKIKAIDPLSRQFLVVKNPQRKGESDDFAAFARLELGKAAYYLP
VLSASKPQLELFDEIWKEGMKPEEWLDTYLEQANLI
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c62972-60342 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGTATGCCCTTATTCTTCCTGGCTGGTATGCCATCAGGCGTGTAACACAGTTTGATGAACGCTTTTTTG
ACCTTCTGTATCTGAGAACTCTTGTCAAAGGGCATCCTTTATCAAACAAGCGATTCAGCGCAGTCCATTA
TGCGGGGAGCCAGTACGACGAAGTTGATATTTCAAAAGTGGATAACTTTATGAAGCTGAAAGACCAGTCT
TCTGTTGAAGAGTTAATTCCGTACTCTTCACATATCACTGATAATATTATCGTTACAAAAAACCGGGATT
TGCTGGCAACCTGGCAGATAGACGGTGCTTACTTTGAGTGTGTTGATTCTGAAGATTTGTCAATTCTGAC
AGATCAGCTTAATACGCTTATACGTAGCTTTGAAGGGAAATCTGTTACGCTTTATCCTCATCGTATCAGG
TGTAAAAAGGACGTCAGACCAGTATTTAACAGTAAAATTCCTTTTGTGAACAGAGTAATGAATGATTATT
ACGAGTCATTCCCTCAGTCTGAATTTTTCGAGAATAAATTATTTCTGACGATTTGTTTTAAACCTTTTAC
TACGGAAGATAAAGTAACACATTTCTTTTCACGCAGTAAAAAACAAAAAGATATCTTTAAAGAGCCTGTT
AATGAAATGAATGAAATTTGCGACAGGTTGAATACCTATCTGTCCCGTTTTCATTCCCGACGTCTTGGGC
TTTATGAAGATCATGGGGTTGTTTATTCAGATCAGTTATCTCTGTTCCAGTATCTACTTTCTGGTCGATG
GCAAAAGGTCAGGGTTAGCAGTAGTCCGTTTTATACATATCTGGGAGGAAAAGACCTGTTCTTTGGTAAT
GATGCCGGACAAATTACCGCGTCAGACCATGCCCGGTATTTTCGTTGCATAGAGATTAAGGATTATTTTC
AGGAGACGGATGCCGGTATTCTGGATGCTCTGATGTATCTCCCCGTTGAGTATGTCGTGACATCGTCCTT
TACTGCGATGGATAAGCAGTCAGCGATTAAGGCGCTGGATGATCAGATCGATAAGCTGGAAATGACAGAT
GATGCTGCCAAATCTTTGCTGGCAGATCTGAAAGTCGGACTGGATATGGTTTCCAGTGGATATATTTCTT
TCGGGAAATCGCATCAGACCCTGGTTGTCTTTGCGGATTCACCGGAGCGTCTGGTGAAAGACACCAATAT
CGTGACTTCCACTCTGGAAGATTTGGGGCTGATTGTCACTTATTCAACACTGAGTCTTGGCGCAGCTTAT
TTTGCTCAGCTACCAGGAAATTATACGCTTCGCCCTCGTCTGAGTACCCTCAGTAGTCTTAATTTTGCCG
AAATGGAAAGTTTTCATAATTTCTTTTCAGGAAAAGAAAAAGGAAATACCTGGGGGGAAAAACTGATTAC
TCTTCGGGGGTCAGGTAATGATATCTACCATCTGAATTACCATATGACGACTGAACATCAGAATTTCTTC
GGTAAGAACCCGACGCTGGGGAATACCGAAATTCTCGGTACGTCTAACGTGGGTAAAACCGTATTACTGA
TGACAAAAGCATTTGCCGCCCAGCAGTTCGGTACGCCGGAATCATTCCCTGCAAACAGAAAACTGAAAAA
ACTGACCACGGTTTTTTTCGATAAAGACCGGGCAGGTGAAGTCGGTATACGGGCAATGGGGGGATCTTAT
TACCGGGTGAAGGAGGGAGAGCCGACAGGCTGGAATCCCGCCGCACTGCCGCCAACAAAACGTAATATCG
CTTTTATGAAGGACCTGGTGAGGCTGCTTTGTACTCTCAACAGTGAGCCGCTCGATGATTACCAGAACAG
CCTGATTTCAGATGCGGTTGAACGTCTTATGCAACGGTCAGATCGCTCTTATCCTATCAGTAAACTACGG
CCTCTTATCCAGGAGCCGGATGATACTGAAACCAAACGTCATGGACTTAAAGCCCGTCTTAAGCCGTGGA
CGCAGGGGGAAGAGTTTGGCTGGGTGTTCGACAATCGGGAAGACACGTTTGATGTCGATAACCTGGATGT
TTTCGGTATTGATGGAACGGAGTTCCTGGATAATAAGGTGCTGGCCAGTGCTGCTTCATTCTATCTCATC
TATCGGGTCACCATGTTGGCCGATGGTCGCAGGCTTCTTATCTACATGGATGAGTTCTGGCAATGGATCA
ATAACGAAGCGTTCAGGGACTTTGTTTACAACAAGCTGAAAACCGGACGTAAACTCGATATGGTGCTTGT
CGTAGCCACACAGTCACCGGATGAACTGATTAAATCACCCATTGCGGCAGCGGTTCGTGAGCAATGCGCC
ACTCATATCTATCTGGCAAACCCGAAAGCCAAACGTAGTGAATATGTTGATGGTTTGCAGGTCAGGGAGC
TTTATTTTGACAAAATTAAAGCTATTGATCCGCTGTCCCGCCAGTTCCTGGTTGTTAAGAACCCACAGAG
GAAAGGTGAAAGTGATGATTTTGCTGCTTTTGCCAGACTGGAGCTGGGAAAAGCAGCGTATTACTTACCG
GTTCTCAGTGCATCAAAACCCCAGTTAGAACTGTTCGATGAAATCTGGAAAGAAGGAATGAAGCCGGAAG
AGTGGCTTGATACCTATCTGGAACAGGCGAACCTTATTTGA
 Primer design