SecReT4
Protein ID: 198241713
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0099
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]58202..59335 [-]
Productpilx6 protein
Component typeVirB6
UniProt IDB5FGZ4
KEGG IDsed:SeD_B0099
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5e-33, Aligned region: 69..285
Protein Sequence: 377 a.a.     [Download]
>gi|198241713|ref|YP_002213929.1| pilx6 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MGIVTGIPDGTDLSGNVTSPANAGGVPGFNSDFFQTTHEVIFNILNKSISGKLSEYSDVAYTLGKYGVSL
YVLWYAFTVLARKQQTPVPDFIWNICRFYIILLFVKNTGGILTSATDAIDGLKNTLAGGDPWVWMDQLWV
KVIQVATLIFDKDTSTVPVAGGIGALLTYVGGVLALLLCSIVFASAELTLLLLSVTAPIFIMCLMFGFLR
QMFNSWLQLNFSSLLVFLFAALALRAGTWQLNMALSTSIATASENNLLQTGVTSLAAGIFMAWIIWQAKS
YASQIAGVGVEGAMQGAAAMGIGAGVFGASRMARGALGMGRNAGIGAWKGLRRQEGGFGQSPGITGKTAN
LAGQGVNIGAKKLRQAAIERAKKMYGG
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c59335-58202 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGGGGATTGTCACTGGTATACCGGATGGTACTGATTTATCAGGTAATGTAACCTCTCCCGCAAATGCGG
GAGGTGTTCCTGGGTTTAATTCTGATTTTTTTCAGACAACTCATGAAGTTATATTTAATATTCTCAATAA
GAGTATATCTGGAAAATTAAGTGAATATTCAGATGTGGCTTATACTCTTGGTAAATATGGAGTTTCTCTG
TATGTTTTATGGTATGCCTTTACTGTATTAGCAAGGAAACAACAGACACCTGTACCTGATTTTATCTGGA
ATATCTGTAGGTTTTACATAATATTGCTTTTTGTTAAGAATACAGGGGGAATACTTACATCAGCAACAGA
TGCTATTGATGGATTGAAAAATACATTGGCAGGGGGAGATCCGTGGGTATGGATGGATCAGTTATGGGTG
AAGGTTATACAAGTTGCAACTCTTATTTTTGATAAAGATACATCTACTGTGCCTGTTGCCGGTGGGATTG
GTGCTTTATTAACTTATGTTGGTGGAGTTTTGGCATTATTGCTTTGTTCTATAGTATTTGCATCTGCTGA
ATTAACATTACTATTACTTTCTGTCACTGCGCCAATATTTATCATGTGTTTGATGTTTGGTTTCCTTCGG
CAAATGTTTAATAGCTGGCTACAGCTTAATTTTAGCTCGTTACTGGTTTTTCTATTTGCAGCATTAGCAC
TAAGAGCTGGGACATGGCAATTAAACATGGCATTAAGTACGTCTATTGCTACAGCATCAGAAAACAATCT
TCTTCAAACGGGAGTAACTTCATTAGCTGCTGGCATTTTCATGGCCTGGATTATCTGGCAGGCGAAAAGT
TATGCTTCACAGATTGCAGGTGTGGGTGTTGAAGGTGCCATGCAGGGCGCAGCCGCTATGGGGATTGGTG
CTGGCGTTTTCGGTGCATCCCGTATGGCGCGTGGCGCACTTGGTATGGGCAGAAATGCCGGTATTGGTGC
ATGGAAAGGTCTGCGTCGTCAGGAAGGCGGGTTTGGTCAGTCTCCGGGAATAACGGGTAAGACCGCTAAC
CTGGCCGGACAGGGCGTTAATATTGGTGCCAAAAAGCTTCGTCAGGCAGCTATTGAGAGGGCAAAGAAAA
TGTATGGAGGGTGA
 Primer design