SecReT4
Protein ID: 198241714
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0092
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]52238..54073 [-]
ProductTaxB
Component typeVirD4
UniProt IDB5FH92
KEGG IDsed:SeD_B0092
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.7e-142, Aligned region: 102..571
TraG-D_C [PF12696], Evalue: 1.4e-24, Aligned region: 416..534
TrwB_AAD_bind [PF10412], Evalue: 3.9e-19, Aligned region: 331..548
Protein Sequence: 611 a.a.     [Download]
>gi|198241714|ref|YP_002213924.1| TaxB [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRTDIRLTAIPS
LLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGVYKGKYLWYTAPD
FVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNPLF
YIDLKAESGAKDLLKLIEILFPSYGMTGAEAYFNNLAGQYWTGLAKLLHFFINYEPPWLNEFGLKPVFSI
GSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLFYL
PTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLMFL
DEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSVHPCRIIYAVSEEDDAAKIS
EKLGYITTTSKSTSKSRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLDPY
FMDRLMKVSPKLASLTMELNKTEKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c54073-52238 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGTCTTTAAAACTCCCAGATAAAGGCCAGTGGGCTTTTATCGGTCTGGTTATGTGTCTCGTGACATATT
ATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTTTGATTC
CATGCTCCTGTGGCGAATAATAACAGAGAGTAATATACGGACAGATATCAGGTTAACCGCTATCCCCTCT
CTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTTTTTATTATCTGGCAACTGAATAAAACAGATG
TTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGAAAATCGAAACTTCTGAAATGGGA
GAAAGAAAACGATACTGATATTCTCGTCGGGGTATATAAAGGTAAATACCTGTGGTATACCGCACCAGAT
TTTGTATCACTTGGCGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTCTGGTCA
GAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCGTGAAAT
ACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCCCTTTTC
TATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTCCGTCTT
ATGGCATGACAGGGGCAGAAGCGTACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGCTAAGTT
GCTTCATTTCTTTATTAACTATGAGCCGCCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTCTCAATC
GGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAACTGGAGG
GAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGAATATCA
CGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTTTATCTC
CCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATATCACTG
TTTATGTCGGTGTTAATGCGGAAGATATATCACTGGCTTACGATTTTCTGAACCTGTTTTTCAACTTCGT
TGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGTCTGATGTTTCTT
GATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGGTCAGGGTATATTGCAGGTTTTAAAC
TTAAGCTTCTGACAATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGCCAAAAC
GCTGATGAGTGTTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGACGATGCCGCGAAGATATCA
GAAAAACTTGGGTATATTACTACTACCTCAAAGAGCACAAGCAAGAGCCGGGGACGCTCAACATCACAGG
GCGAATCAGAAAGTGAAGCCCGAAGAGCTCTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTTTAAAGA
AGAGTTTATCATCCTGAAGGGAGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGATCCGTAT
TTTATGGACAGATTAATGAAGGTGAGTCCCAAACTGGCATCATTGACGATGGAACTAAATAAGACGGAAA
AAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAGCTGGAGTC
TGAGGTTTTGCTATGA
 Primer design