SecReT4
Protein ID: 198241736
T4SS name [ID]VirB [464]
Gene symbol-
Locus tagSeD_B0096
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconplasmid pCT02021853_74 [GenBank: NC_011204] [Browse all T4SS(s) in this replicon]
Location [Strand]56310..57239 [-]
Productpilx9 protein
Component typeVirB9
UniProt IDB5FH94
KEGG IDsed:SeD_B0096
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.4e-48, Aligned region: 31..285
Protein Sequence: 309 a.a.     [Download]
>gi|198241736|ref|YP_002213926.1| pilx9 protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MKMNKGALIMALLMAAHVCNAAVLPSGSRFDPRNQIVSYNPNNTTIINSAVGYTTTLVFDEDETVISART
GFPQGWAVNKEDNLVYLEVRPVKQTVQKNNTDANGNTSSESVSVALDPENELERWRMNLFVRTTKRNYSM
ELNARTFRQPEKIAFVVNYQYPQERRKEQAEIEKKRTEALARRLEEQAINRSLENAKSPRNWQYWKRVAE
GSQDISPDYAYDDGRYTWFGFSPLKKIPSVFVMNGMQETLTNPVIKQSGSFTAVGVPVDKRFVLRLGEQV
VGIENLGFGKVRLPAGDTVSPDVKKEVIQ
 
Nucleotide Sequence: 930 bp     [Download]
>gi|198241636|ref|NC_011204.1|:c57239-56310 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence
ATGAAAATGAATAAAGGAGCGTTAATTATGGCGCTTCTGATGGCGGCGCACGTCTGTAATGCTGCTGTTC
TTCCTTCAGGCAGTCGCTTTGACCCACGCAATCAGATAGTCAGTTATAACCCCAATAATACCACCATAAT
TAACAGTGCCGTTGGATACACCACCACACTGGTATTTGATGAAGATGAAACAGTTATCAGTGCCAGAACC
GGTTTTCCGCAGGGATGGGCGGTTAATAAAGAAGATAACCTGGTATACCTGGAAGTTCGTCCTGTTAAAC
AAACTGTTCAGAAAAATAATACGGATGCAAACGGTAACACCTCTTCTGAATCCGTCAGTGTTGCTCTTGA
CCCGGAAAATGAGCTTGAACGCTGGCGAATGAATCTGTTTGTTCGCACCACGAAACGTAATTACAGCATG
GAGCTGAACGCCAGAACGTTCCGACAGCCGGAGAAAATTGCGTTTGTGGTGAATTACCAGTATCCGCAGG
AACGCCGGAAGGAACAGGCCGAAATTGAGAAGAAACGCACAGAGGCTCTTGCCAGACGCCTGGAGGAACA
GGCAATCAACCGTTCCCTGGAAAATGCGAAATCGCCCCGTAACTGGCAGTACTGGAAGCGGGTTGCTGAA
GGCAGCCAGGATATCAGCCCTGATTATGCATATGACGATGGTCGTTATACCTGGTTCGGCTTCAGTCCGT
TAAAGAAAATTCCCAGCGTCTTTGTGATGAACGGTATGCAGGAGACTCTTACCAATCCTGTGATTAAACA
GAGCGGGAGTTTTACGGCTGTTGGCGTACCGGTTGATAAGCGTTTTGTTTTACGTCTTGGTGAGCAGGTG
GTGGGGATTGAGAACCTGGGCTTCGGAAAAGTACGTTTACCAGCCGGAGATACGGTATCCCCGGATGTTA
AGAAAGAGGTGATCCAGTGA
 Primer design