SecReT4
Protein ID: 198282389
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0245
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]232898..233284 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB5EKP1
KEGG IDafe:Lferr_0245
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-09, Aligned region: 6..88
Protein Sequence: 128 a.a.     [Download]
>gi|198282389|ref|YP_002218710.1| conjugal transfer protein TrbC [Acidithiobacillus ferrooxidans ATCC 53993]
MEKRLKAMFSGVRKVSAAGLMVLAPGMAFASTSGGVFSPITGPLNTVLTGMQDMGGLVAAGGVVATGLSW
WHGGEHKKAMMIGLGATVGGIAMANAKSLATSITGGATMGHVGIMGLAASHALHVVGL
 
Nucleotide Sequence: 387 bp     [Download]
>gi|198282148|ref|NC_011206.1|:232898-233284 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGGAAAAGCGGTTGAAGGCAATGTTCTCTGGAGTTCGCAAGGTCAGCGCGGCGGGCCTGATGGTCCTGG
CCCCCGGCATGGCGTTCGCGTCCACGTCCGGCGGTGTGTTTTCTCCCATTACGGGGCCGCTGAATACGGT
CCTGACGGGCATGCAGGACATGGGCGGACTGGTCGCCGCTGGCGGCGTAGTCGCGACGGGTCTCTCCTGG
TGGCATGGCGGCGAGCACAAGAAGGCCATGATGATTGGCCTGGGTGCGACGGTCGGCGGCATTGCCATGG
CGAATGCGAAATCGCTCGCCACCAGCATCACCGGCGGTGCCACGATGGGGCATGTGGGCATCATGGGCCT
CGCCGCATCGCACGCGCTGCACGTCGTGGGGCTCTAG
 Primer design