SecReT4
Protein ID: 198282391
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0247
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]233665..236187 [+]
ProductCagE TrbE VirB component of type IV transporter system
Component typeTrbE
UniProt IDB5EKP3
KEGG IDafe:Lferr_0247, afe:Lferr_1339
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.6e-32, Aligned region: 469..734
CagE_TrbE_VirB [PF03135], Evalue: 2.5e-19, Aligned region: 191..292
CagE_TrbE_VirB [PF03135], Evalue: 2.5e-19, Aligned region: 309..406
Protein Sequence: 840 a.a.     [Download]
>gi|198282391|ref|YP_002218712.1| CagE TrbE VirB component of type IV transporter system [Acidithiobacillus ferrooxidans ATCC 53993]
MRSLKQYRDKALGLPDLLNIAFLVDGWQTDAGEMAIALQKDGSFLAGFRYDGPDLESQSTQDLEALSATW
NNAIARLGTDWGVHVTAIREPADGYIDESECAFRDPVSRLIEAERRAQFGSETHHYVSRYYLTVAWRTPI
DAEVQLVQSMIQKKAGKQPGQLADAAFRDTLARYRQVIEVILGIFRHGYRVKAMDADALLTHIHECLTGA
THRVNAPRIPAYLDALIGHHDFVGGLEPSMDGEEIRVVTVLGYPSMTFPEMLENLHSLPIPLRYTLRFLP
LDPPDAVADMAKIRDRWFGSRANMKSLLTEKMTGEAQGQLSADDTVVNLAYDAKQAVNEAREGAVKFGNF
TLSVVLRSADEKVLADRIKAIKTFLDNAGYVAHLETTNTVEAFLGSLPGHLYENIRRPLMHSLNVADFAP
KTEIWAGEARCPSPLMNLSDGRKAPPLLYAATTGNTPFRLNLHVGDLGHSLIAGMTGGGKSTLLALLAAQ
WQRYPDSRVIAFDKGMSLYALTEAMGGQHYDLNGPTSDLFFAPLQHVDDPAEAAFAADWVEALATLQGMT
ITSTERSAIRDAVHGLARESGRSLTALLQMIQNRGIKDALQYYTLTGQTGKLLDAESDGLSMADASMITF
EMSHLMNGGPAEHRVTVPVLLYLFHRIEQMLDGRPTLILLDEAWTFLDNELFLAKLRQWLKELRKKNAAV
VFATQSLNDLKNSSLLPVLKESCPTKIFLPNRAATSPDLKPLYIDMGLNDRQIELVVASTPKQDYYLSTP
EGQRRIQFGMGPVTLAFCGVSDPREVKRVAELKTQHGDRWPIAWLKERLSPSIRDGWVSYAESLYQGERA
 
Nucleotide Sequence: 2523 bp     [Download]
>gi|198282148|ref|NC_011206.1|:233665-236187 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGCGCTCCCTGAAACAGTACCGTGATAAGGCCCTGGGCCTTCCCGATCTTTTGAACATCGCTTTTCTGG
TGGATGGCTGGCAGACGGATGCCGGGGAAATGGCCATCGCGCTGCAAAAAGACGGGAGCTTTCTGGCGGG
GTTCCGCTATGACGGGCCTGATCTCGAGAGCCAGTCCACGCAGGATCTGGAGGCGCTCTCGGCCACCTGG
AACAACGCCATCGCTCGATTGGGCACAGACTGGGGTGTGCATGTCACGGCGATTCGCGAGCCGGCCGACG
GCTATATCGACGAATCGGAGTGCGCCTTTCGCGACCCGGTGTCGCGCCTCATCGAGGCCGAGAGGCGGGC
GCAGTTTGGATCGGAAACCCATCACTATGTCAGCCGCTATTACCTTACAGTTGCCTGGCGAACGCCCATT
GATGCGGAAGTGCAGTTGGTACAGTCCATGATCCAAAAGAAAGCCGGTAAACAACCCGGGCAGCTGGCCG
ATGCGGCATTCCGGGACACGCTGGCCCGCTACCGGCAGGTGATTGAAGTTATCCTGGGCATTTTCAGGCA
CGGATACCGGGTGAAGGCCATGGATGCCGACGCCCTGCTGACCCATATCCATGAGTGCCTGACCGGCGCC
ACGCATCGCGTCAATGCGCCCCGGATTCCGGCGTATCTGGATGCCCTCATCGGGCACCATGATTTTGTGG
GCGGTCTGGAGCCGTCCATGGACGGGGAAGAGATTCGCGTCGTAACGGTTCTGGGCTATCCCAGCATGAC
CTTCCCCGAGATGCTGGAGAACCTGCATAGCCTGCCCATTCCCCTACGCTACACGCTCCGCTTCCTGCCC
CTTGATCCGCCGGATGCGGTGGCGGACATGGCGAAGATCCGGGATCGCTGGTTTGGCTCCCGGGCCAACA
TGAAATCCCTGCTTACGGAGAAGATGACGGGCGAAGCCCAGGGACAGTTGTCCGCCGACGATACGGTGGT
GAACCTCGCCTATGACGCCAAGCAGGCCGTCAATGAGGCGCGGGAGGGCGCTGTGAAGTTTGGCAACTTC
ACGCTATCCGTCGTGCTGCGTTCCGCCGATGAAAAAGTGCTCGCGGACCGGATCAAGGCGATCAAGACCT
TCTTGGACAATGCGGGCTATGTCGCCCACCTGGAAACGACCAATACGGTGGAAGCGTTCCTGGGCAGCCT
CCCGGGTCATCTCTATGAGAACATCCGCCGGCCACTGATGCACTCGCTGAATGTTGCGGATTTCGCGCCC
AAGACGGAAATCTGGGCCGGTGAAGCGCGTTGCCCGAGTCCGCTGATGAATTTGTCTGACGGCCGCAAAG
CTCCGCCCCTGCTGTACGCGGCGACCACGGGAAATACGCCCTTCCGACTGAATCTCCATGTCGGCGATCT
GGGGCACAGCCTGATTGCCGGCATGACCGGGGGCGGAAAGAGTACGCTCCTGGCCCTGTTGGCCGCGCAA
TGGCAACGTTATCCCGACAGCCGGGTGATTGCCTTCGACAAGGGCATGAGTCTCTACGCCCTCACGGAAG
CCATGGGTGGGCAGCATTATGATCTGAACGGCCCGACCTCCGATCTGTTTTTTGCACCCCTGCAGCACGT
CGATGATCCGGCCGAGGCGGCTTTTGCGGCCGACTGGGTGGAAGCGTTGGCCACCTTGCAGGGCATGACG
ATCACCTCTACGGAGCGTTCGGCCATTCGTGACGCTGTGCATGGCCTGGCCCGGGAATCCGGGCGCTCGC
TCACGGCGCTGCTTCAGATGATCCAGAACCGGGGGATCAAGGATGCCCTGCAGTATTACACCCTGACCGG
GCAAACGGGGAAGCTGCTTGATGCCGAGAGTGACGGGCTGTCGATGGCCGATGCGAGCATGATCACTTTC
GAGATGAGTCACCTGATGAACGGCGGCCCGGCGGAGCACCGGGTAACGGTTCCGGTACTGCTGTATCTGT
TCCACCGGATCGAACAGATGCTGGATGGGCGACCCACCCTCATTCTGCTCGATGAGGCCTGGACCTTTCT
GGACAACGAGCTGTTTCTGGCGAAGTTGCGTCAATGGCTGAAGGAACTGCGGAAGAAAAACGCCGCCGTC
GTTTTTGCCACACAGTCCCTGAATGATCTCAAGAACAGCTCCTTGCTCCCGGTCCTGAAGGAGTCCTGCC
CGACGAAAATCTTCCTGCCCAACCGGGCTGCCACCAGTCCGGACCTCAAGCCCCTGTACATCGACATGGG
GCTGAATGATCGGCAAATCGAGCTGGTGGTGGCGTCCACGCCGAAGCAGGACTACTACCTGTCCACCCCA
GAGGGGCAGCGCCGGATTCAGTTTGGCATGGGTCCGGTCACCCTGGCTTTTTGCGGTGTCTCCGATCCGC
GTGAGGTCAAGAGGGTAGCGGAGCTCAAGACGCAGCACGGCGATCGCTGGCCGATCGCCTGGCTGAAAGA
GCGGCTGTCACCCAGCATCCGGGATGGGTGGGTGAGCTATGCGGAGTCCCTTTACCAGGGAGAACGGGCA
TGA
 Primer design