SecReT4
Protein ID: 198282395
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0251
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]238449..240140 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB5EKP7
KEGG IDafe:Lferr_0251
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-17, Aligned region: 72..309
Protein Sequence: 563 a.a.     [Download]
>gi|198282395|ref|YP_002218716.1| P-type conjugative transfer protein TrbL [Acidithiobacillus ferrooxidans ATCC 53993]
MRGHRRFPWVVGMFLGAVPAISFAAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLAAVEFSVLFLN
HVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSGTWIPDIINGLAGGAHALGVTAVTPGQIATEALQAFLG
IVLSPIAAATHNASNTFSDIFSGNFSAAFSYAAKTVASSNPASLLVETLLAGIIGLLAGMGILVMALEFL
MVQIESYLVIALGVIMLAGGGLRWTAKYVGSYFDYAINVGVRLFVLTALAYLVTYSIVPLIQTILENVTN
PLQAGFEVLILGAVIALLPRKASSIASSLLSGNSSFSGGELVKEGGMIAGGTVAAGAAGVGLAAAAGGGL
AAGGLSAAAGAGGGAAGGAGSLAGGGLAGAAGAGEAGAAAGVAAPEAGAMSAGGGASSGAGAGNAVPAPS
AGGSAGGEAPQAARAVQAPATSTQSTGQQNPSKGVEAPTQEAGKEAGQDKRNDQEMSASEPFAGGEPHPD
APPAPVNAVPAPDPVSTPSGGGNQGSTAAPAPKSAVDKLTDSFVNHAKDIAINQSKEKVGVNKLDVGHMR
DFD
 
Nucleotide Sequence: 1692 bp     [Download]
>gi|198282148|ref|NC_011206.1|:238449-240140 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGCGTGGACACCGCAGGTTTCCGTGGGTCGTGGGCATGTTTCTGGGTGCCGTCCCCGCCATATCATTCG
CAGCGGGTTCGGGATCGTTGAGTCAGGTACAAAGCCTTTTGCGAGGCAAAATTCTTCCCTGGCAAAGTGT
CATGCAAACGGCGGCCACGGATCTGTTCTACGTCCTGGCGGCGGTCGAGTTCTCCGTCCTCTTTTTGAAC
CATGTTCTGCAAAAGCGTGGGCACGAAGATCTCTTTGCCGGTATCATCAAGAAGGTGGTGACGCTGGGTT
TTTTTCTGACCCTGCTGGACAACTCCGGGACCTGGATTCCCGACATCATCAATGGTCTGGCCGGTGGAGC
GCACGCGCTTGGAGTGACGGCTGTGACGCCCGGGCAGATCGCGACGGAGGCTCTTCAGGCATTTCTCGGG
ATCGTGCTGTCTCCAATAGCTGCCGCCACCCACAACGCGAGCAATACCTTCAGCGACATTTTCAGTGGTA
ACTTCTCTGCGGCTTTCTCTTATGCGGCCAAAACGGTCGCCAGCAGCAATCCGGCATCGCTCCTGGTAGA
GACCCTCCTGGCGGGGATCATTGGTCTGCTGGCGGGGATGGGTATTCTGGTCATGGCCCTGGAGTTCCTG
ATGGTCCAGATCGAGAGCTACCTAGTGATCGCCCTGGGCGTGATCATGCTGGCCGGCGGCGGGTTGCGCT
GGACGGCAAAGTATGTCGGCAGTTACTTCGATTACGCCATCAACGTGGGTGTCCGTCTTTTTGTCCTGAC
CGCGCTGGCGTATCTGGTGACCTACAGCATCGTGCCGCTGATCCAGACGATCCTGGAGAACGTCACCAAT
CCCCTACAGGCGGGATTTGAGGTGCTCATCTTGGGCGCCGTCATCGCGCTGCTTCCCCGCAAGGCGTCCA
GCATAGCGAGCAGTCTTCTGAGCGGTAACTCATCCTTCTCCGGCGGAGAACTGGTCAAGGAAGGCGGGAT
GATCGCCGGTGGCACGGTAGCGGCAGGAGCTGCTGGCGTGGGCCTGGCCGCCGCTGCGGGCGGGGGGCTC
GCCGCTGGTGGACTATCCGCAGCGGCGGGTGCTGGAGGCGGTGCGGCCGGAGGTGCTGGCAGCCTCGCAG
GCGGCGGCCTTGCCGGAGCGGCGGGCGCGGGAGAAGCCGGCGCTGCGGCTGGTGTGGCGGCCCCGGAAGC
TGGGGCGATGTCCGCAGGCGGTGGCGCGAGTTCCGGCGCGGGTGCGGGGAACGCCGTACCGGCCCCCAGC
GCTGGCGGTTCGGCGGGTGGTGAGGCTCCACAGGCAGCCAGGGCTGTGCAGGCTCCAGCGACCAGCACGC
AATCCACTGGTCAGCAAAACCCATCCAAGGGTGTCGAGGCACCGACCCAGGAAGCTGGAAAGGAAGCTGG
CCAGGATAAGCGGAACGATCAGGAAATGAGCGCAAGCGAACCCTTCGCAGGGGGCGAACCCCATCCCGAC
GCGCCGCCCGCTCCGGTCAATGCCGTCCCCGCTCCTGATCCCGTCAGTACGCCTTCTGGCGGTGGCAATC
AGGGAAGCACGGCGGCTCCGGCTCCGAAGTCGGCAGTGGACAAGCTGACAGATAGCTTTGTGAATCATGC
GAAGGATATCGCGATAAACCAGTCAAAAGAGAAGGTGGGGGTGAACAAGCTCGACGTTGGGCATATGAGG
GACTTCGACTGA
 Primer design