SecReT4
Protein ID: 198282401
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0257
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]244153..245253 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDB5EKQ3
KEGG IDafe:Lferr_0257
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-24, Aligned region: 140..364
Protein Sequence: 366 a.a.     [Download]
>gi|198282401|ref|YP_002218722.1| conjugal transfer protein TrbG/VirB9/CagX [Acidithiobacillus ferrooxidans ATCC 53993]
MKTKTLLSLGLAVLPGLALAGVDTGLPAVNPISSLQGKPPIQPAGTKTGSAHPSTTPSASGGTTSAGQKV
PAISPEAAARMATAHVWQQSIATPPEGPESAPTRMLARQSLTASRAMDDTLPVIGGANGTVNSLAGRPVL
VCSPLHTCIIELPEGVKPVTTVGISKSEWNVQQALVGKQPEIFLSPKFKGLHQNIVVAATDQGRPINYEI
RLVSDAVRYIPALKIEDSGGEVRSWKTDLQSADNAPTDQSAAGHKGNVLPLPNIRLNHLNLRWSIHCGGG
GWFSSSDCKPIRPLRVYDDGTHTFIDMPQGLASHGGFPVLQARNASGHLIGVDTQIRGNTYVVDSVPADI
LLRLGSEMVTIQKEGK
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|198282148|ref|NC_011206.1|:244153-245253 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGAAAACCAAGACATTGCTTTCTTTGGGGCTTGCCGTCCTTCCTGGATTGGCGCTGGCAGGCGTGGATA
CTGGACTCCCTGCGGTGAACCCGATCAGTTCGCTGCAGGGAAAACCGCCAATACAGCCTGCAGGGACGAA
AACCGGTTCGGCCCATCCGTCCACGACACCATCCGCATCTGGCGGCACCACGTCTGCGGGCCAGAAAGTC
CCGGCCATCTCCCCGGAGGCTGCCGCGCGGATGGCAACGGCGCATGTGTGGCAACAGTCCATAGCGACTC
CGCCAGAGGGGCCAGAGAGTGCCCCAACCAGGATGCTGGCCCGTCAGTCGCTGACGGCGTCACGGGCGAT
GGACGACACCCTTCCGGTGATCGGCGGCGCGAACGGGACCGTCAACAGCCTTGCCGGTCGCCCCGTGCTG
GTCTGTTCACCGCTGCACACCTGCATCATCGAGCTGCCCGAGGGCGTCAAGCCCGTGACGACCGTCGGGA
TCAGCAAGTCGGAATGGAATGTGCAACAGGCGCTGGTTGGGAAACAGCCGGAAATCTTTCTGAGCCCGAA
ATTCAAGGGTCTCCACCAAAACATCGTGGTGGCCGCGACCGACCAGGGCAGGCCCATCAACTATGAAATC
CGTCTGGTCAGTGACGCAGTGCGCTACATTCCCGCCCTGAAGATCGAGGATAGCGGGGGCGAGGTCCGTT
CCTGGAAAACAGACTTGCAGTCAGCAGACAACGCACCAACGGATCAGTCGGCTGCCGGCCATAAAGGCAA
TGTACTGCCTCTGCCCAATATCCGTCTCAACCACCTCAATCTTCGCTGGTCCATTCATTGCGGTGGCGGT
GGATGGTTCAGTTCCAGCGATTGCAAACCGATCCGTCCATTGCGCGTGTATGACGATGGGACCCATACCT
TCATCGACATGCCCCAGGGGCTGGCGAGCCACGGAGGATTCCCCGTCCTGCAAGCCCGCAATGCCAGTGG
ACACCTGATCGGAGTCGATACCCAGATCCGGGGCAACACCTATGTCGTCGATTCAGTTCCTGCCGATATC
CTGTTACGGCTGGGTTCTGAGATGGTCACCATCCAGAAGGAGGGGAAGTAG
 Primer design