SecReT4
Protein ID: 198282405
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0261
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]247987..248664 [+]
ProductLytic transglycosylase
Component typeTrbN
UniProt IDB5EKQ7
KEGG IDafe:Lferr_0261
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 225 a.a.     [Download]
>gi|198282405|ref|YP_002218726.1| Lytic transglycosylase [Acidithiobacillus ferrooxidans ATCC 53993]
MIPLSQISAECAPMVARSTMAAIVRVESGGNPLAMWNNSTRSMVIPCSRAQAIQYLRKAMAAGQRVDVGL
AQVDTGNFSAFGLTPRTAFNACTNLRAGSEILHMDWQQARENGYRGQQALYHAFEAYNSGRLRGDAQYAN
RILGAAGVFAPAGRKPAGRKPAGRKPADYGGLRTISQVNAALPTNPFPQFRWLAAGGLAADGQAKSVQAV
TTGPSDDSHSWPVLP
 
Nucleotide Sequence: 678 bp     [Download]
>gi|198282148|ref|NC_011206.1|:247987-248664 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGATCCCACTATCCCAGATCAGTGCGGAATGCGCCCCCATGGTTGCACGCTCGACGATGGCCGCCATTG
TGCGGGTGGAGTCCGGGGGCAACCCGTTGGCGATGTGGAACAACAGCACGCGGAGCATGGTCATTCCCTG
CAGTCGGGCTCAGGCCATCCAGTATTTGCGGAAAGCCATGGCCGCTGGCCAGCGGGTCGACGTAGGGCTG
GCCCAGGTGGATACCGGGAACTTCTCAGCCTTCGGGCTCACTCCCAGGACAGCCTTCAATGCCTGCACCA
ACCTTCGGGCAGGCAGCGAGATCCTGCACATGGATTGGCAACAGGCGCGGGAGAATGGCTATCGGGGCCA
ACAAGCGCTCTACCATGCCTTTGAAGCGTACAACTCCGGGCGGCTCCGGGGCGATGCCCAATATGCCAAC
CGGATACTGGGCGCCGCTGGAGTATTCGCGCCTGCCGGCCGCAAGCCTGCCGGCCGCAAGCCCGCCGGCC
GCAAGCCTGCCGACTACGGCGGACTGCGCACCATCTCCCAGGTCAATGCGGCACTGCCGACCAATCCCTT
TCCTCAATTTCGGTGGCTTGCCGCCGGCGGGCTTGCAGCCGACGGGCAGGCAAAATCGGTTCAGGCGGTA
ACCACCGGACCATCAGATGACTCCCACTCCTGGCCGGTTCTCCCATAA
 Primer design