SecReT4
Protein ID: 198282418
T4SS name [ID]Trb [482]
Gene symbol-
Locus tagLferr_0276
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]261781..262371 [-]
ProductType IV secretory pathway protease TraF-like protein
Component typeTraF
UniProt IDB5EKS0
KEGG IDafe:Lferr_0276
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.3e-21, Aligned region: 39..184
Protein Sequence: 196 a.a.     [Download]
>gi|198282418|ref|YP_002218739.1| Type IV secretory pathway protease TraF-like protein [Acidithiobacillus ferrooxidans ATCC 53993]
MQRISAAIAKRLLWWGAWAIIGVLVLNAAVGLWMQYQHLVFNDSTCEPVGLYQLRGSPYPLHHGELVEVE
IPGPAHHATVAEGLKYHWFPAGQPWIKEIAAVPGQTVRLTRSGVRVDGHTLPNSRVDRWTPGHHHRIVHY
PFGTYHLKRGQVWLYAPGNYAFDSSYYGPVPESHILQRVVPWWTIPGSQFWLQKRD
 
Nucleotide Sequence: 591 bp     [Download]
>gi|198282148|ref|NC_011206.1|:c262371-261781 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGCAAAGAATATCCGCCGCAATCGCTAAGCGGCTGCTCTGGTGGGGCGCATGGGCGATCATCGGTGTCC
TGGTGCTGAATGCTGCCGTAGGGCTATGGATGCAGTACCAGCATCTGGTCTTCAACGACTCGACCTGCGA
GCCGGTGGGCCTCTACCAGCTGCGCGGATCTCCTTATCCATTGCACCACGGAGAACTGGTCGAAGTCGAG
ATTCCTGGCCCCGCCCATCACGCCACCGTCGCGGAAGGCCTGAAGTACCACTGGTTTCCCGCTGGACAGC
CGTGGATCAAAGAGATCGCCGCCGTTCCCGGGCAGACCGTGCGGCTTACGAGATCCGGGGTCCGTGTAGA
TGGGCACACACTGCCGAACTCCCGGGTGGATCGCTGGACGCCCGGCCACCATCACCGGATTGTCCATTAC
CCTTTCGGCACCTATCACCTGAAGCGTGGCCAGGTCTGGCTCTACGCCCCAGGAAACTATGCCTTTGACT
CGAGCTATTACGGCCCAGTCCCTGAATCCCACATCCTGCAACGGGTGGTTCCCTGGTGGACGATTCCCGG
AAGTCAGTTCTGGCTGCAGAAGCGAGACTGA
 Primer design