SecReT4
Protein ID: 198283457
T4SS name [ID]Trb [483]
Gene symbol-
Locus tagLferr_1337
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]1290594..1290980 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB5ERQ0
KEGG IDafe:Lferr_1337
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.3e-09, Aligned region: 1..96
Protein Sequence: 128 a.a.     [Download]
>gi|198283457|ref|YP_002219778.1| conjugal transfer protein TrbC [Acidithiobacillus ferrooxidans ATCC 53993]
MKKRLKAIFSGVRKVSAAGLMVLAPGMAFASTSGGVFSPIAGPLNTVLTGMQDLGGLVAAGGFVATGLSW
WHGGEHKKAMMIGMGATVGGIAMANAKSLATSITGGATMGHVGILGLAASHALHVVGL
 
Nucleotide Sequence: 387 bp     [Download]
>gi|198282148|ref|NC_011206.1|:1290594-1290980 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGAAAAAGCGGTTGAAGGCAATATTCTCCGGGGTTCGCAAGGTCAGCGCCGCGGGCCTCATGGTCCTGG
CCCCCGGCATGGCGTTCGCGTCCACATCCGGCGGTGTGTTTTCTCCCATTGCGGGGCCGCTGAATACGGT
CCTGACGGGTATGCAGGATTTGGGCGGGCTGGTCGCCGCTGGCGGCTTCGTCGCGACGGGACTTTCCTGG
TGGCATGGCGGCGAACACAAAAAGGCCATGATGATTGGCATGGGTGCGACGGTCGGGGGCATTGCCATGG
CCAATGCGAAATCGCTCGCCACCAGCATCACCGGCGGCGCCACGATGGGCCATGTGGGCATCCTGGGCCT
CGCCGCATCACACGCGCTGCACGTCGTGGGGCTCTAG
 Primer design