SecReT4
Protein ID: 198283463
T4SS name [ID]Trb [483]
Gene symbol-
Locus tagLferr_1343
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]1295239..1297008 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB5ERQ6
KEGG IDafe:Lferr_1343
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.2e-16, Aligned region: 72..309
Protein Sequence: 589 a.a.     [Download]
>gi|198283463|ref|YP_002219784.1| P-type conjugative transfer protein TrbL [Acidithiobacillus ferrooxidans ATCC 53993]
MRGHRRFPWIMGMLLGAVPGISFAAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLAAVEFSVLFLN
HVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSGTWIPDIINGLAGGAHALGVTAVTPGQIATEALQAFLG
IVLSPIAAATHNLGNTFSDIFSGNFSAAFSSAGKAVASSNPASLLVETLLAGIIGLLAGVGILVMALEFL
MVQIESYLVIALGVIMLAGGGLRWTAKYVGSYFDYAINVGVRLFILTALAYLVTYSIVPLIQTILENVTN
PLQAGFEVLILGALIALLPRKASSIASSLLSGNSSFSGGELAKEGGMIAGGTVALGAAGVGLAAAAGGGL
AAGGLSAAAGAGGGAAGGAGSLAGGLTGAAGAGETGAAAGVAAPEAGAMSASGGASSGAGAGNAVLAPGM
GGSAGSEAPQAARAVQAPAPITQSTGQQNPSKGVEAPSQETVKEAGQDKRNDQEMSASEPFAGGEPQPDA
PPVPVNAVPAPEPVSAPSGGGGQGSTAAPAPGAAVSGGATMDDVVEQLKQMQGQPKGVADRIKKGFAGRF
LKHVEEITTAKSNQVQKNAIDSSHPRDFD
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|198282148|ref|NC_011206.1|:1295239-1297008 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGCGTGGACACCGCAGGTTTCCGTGGATCATGGGCATGCTTCTGGGTGCCGTCCCCGGCATTTCGTTCG
CAGCGGGTTCGGGGTCGTTGAGTCAGGTACAAAGCCTTTTGCGAGGCAAAATTCTTCCCTGGCAAAGTGT
CATGCAAACGGCGGCCACGGATCTGTTCTACGTCCTGGCGGCGGTCGAGTTCTCCGTCCTGTTTCTGAAC
CATGTTCTGCAAAAGCGCGGGCATGAGGATCTCTTTGCCGGTATCATCAAGAAGGTGGTGACGCTGGGGT
TTTTTCTGACCCTGCTCGACAACTCCGGGACCTGGATTCCCGACATCATCAATGGTCTGGCCGGTGGAGC
GCACGCGCTCGGAGTGACGGCCGTGACACCCGGGCAGATCGCGACGGAGGCTCTTCAGGCATTTCTCGGG
ATCGTGCTGTCTCCAATAGCTGCCGCCACCCACAACCTGGGCAATACCTTCAGCGACATTTTCAGTGGTA
ACTTCTCCGCGGCTTTTTCTTCTGCGGGCAAAGCGGTCGCCAGCAGCAATCCGGCATCGCTCCTGGTAGA
GACCCTCCTGGCGGGGATCATTGGCCTGCTGGCAGGCGTGGGCATTCTGGTCATGGCCCTGGAGTTCCTG
ATGGTCCAGATCGAGAGTTACCTGGTGATTGCCCTGGGCGTGATCATGCTGGCCGGCGGCGGGCTGCGCT
GGACGGCAAAGTATGTCGGCAGTTATTTCGATTACGCCATCAACGTGGGTGTCCGTCTTTTTATCCTGAC
CGCGCTGGCGTATCTGGTGACCTACAGCATCGTGCCGCTGATCCAGACGATCCTGGAGAATGTCACGAAT
CCTTTGCAGGCTGGATTCGAGGTGCTTATTCTGGGTGCCCTCATCGCCCTGTTGCCCCGCAAGGCCTCCA
GCATTGCCAGTAGCCTCCTGTCCGGTAACTCATCCTTCTCCGGCGGAGAACTGGCCAAGGAAGGCGGGAT
GATCGCTGGTGGTACGGTAGCACTGGGAGCGGCTGGCGTGGGCCTGGCCGCCGCTGCGGGCGGGGGGCTT
GCCGCTGGTGGACTCTCCGCGGCGGCGGGTGCTGGAGGCGGTGCTGCCGGAGGGGCTGGCAGTCTTGCAG
GCGGCCTTACCGGGGCGGCGGGCGCGGGAGAAACCGGCGCGGCGGCTGGTGTGGCGGCACCGGAAGCTGG
GGCGATGTCCGCAAGCGGTGGCGCGAGTTCCGGCGCGGGCGCAGGGAACGCCGTACTGGCCCCCGGCATG
GGTGGTTCGGCGGGTAGTGAGGCTCCACAGGCAGCCAGGGCTGTGCAGGCTCCAGCGCCCATTACGCAAT
CCACTGGCCAGCAAAACCCATCCAAGGGTGTCGAGGCGCCGAGCCAGGAAACTGTAAAGGAAGCGGGCCA
GGATAAGCGGAACGATCAGGAAATGAGTGCAAGCGAACCCTTCGCAGGGGGCGAACCCCAGCCCGACGCG
CCGCCCGTCCCGGTCAATGCGGTTCCGGCGCCAGAACCCGTCAGCGCGCCTTCCGGCGGTGGCGGTCAGG
GAAGCACGGCGGCTCCGGCTCCGGGTGCGGCCGTGAGTGGCGGTGCCACGATGGACGATGTGGTCGAGCA
GCTGAAACAGATGCAGGGGCAGCCCAAGGGAGTGGCGGATAGGATCAAAAAAGGTTTTGCCGGTAGATTT
CTAAAACATGTGGAGGAAATAACTACGGCAAAATCAAATCAAGTCCAGAAGAACGCCATAGATTCCAGTC
ACCCAAGAGATTTTGATTGA
 Primer design