SecReT4
Protein ID: 198283511
T4SS name [ID]Trb [483]
Gene symbol-
Locus tagLferr_1392
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]1348580..1349248 [+]
Productconjugal transfer protein
Component typeTrbF
UniProt IDB5ERV4
KEGG IDafe:Lferr_1392
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7e-36, Aligned region: 9..220
Protein Sequence: 222 a.a.     [Download]
>gi|198283511|ref|YP_002219832.1| conjugal transfer protein [Acidithiobacillus ferrooxidans ATCC 53993]
MSSNPDYLAARQEWLERYGSYIAQARNWRIAALSAIGIAALFGAGMVYEADRVHIVPYVVEVDKLGKAVE
LAQAVRAGSFAQPVVQHIVSRFTWLAFTRSPDKHVQKHFIDESYHYIASSAESSLDAFYAQHNPYAAYSN
KTQGNTVTIQSAVPVGQVTGKGGSYIVDFLVKHYGPHGGVDGEQNWQGTVTYATVPPSNNPNVLKGNPFG
IYITHFAFSPQV
 
Nucleotide Sequence: 669 bp     [Download]
>gi|198282148|ref|NC_011206.1|:1348580-1349248 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGTCGAGCAATCCCGATTATCTGGCTGCCCGCCAGGAATGGCTTGAGCGCTACGGCTCCTACATCGCGC
AGGCGAGAAACTGGCGCATCGCTGCCCTGTCGGCTATCGGCATTGCCGCCCTGTTTGGGGCGGGCATGGT
GTACGAGGCAGACCGTGTCCATATCGTGCCCTATGTCGTCGAAGTGGACAAACTGGGCAAGGCTGTGGAA
CTGGCGCAGGCCGTGCGGGCCGGTTCTTTCGCCCAGCCGGTAGTGCAGCACATCGTTTCCCGCTTCACCT
GGCTCGCTTTCACGCGCAGCCCGGACAAGCATGTGCAGAAGCACTTCATCGATGAATCCTATCATTACAT
CGCATCGAGCGCGGAATCCTCGCTGGACGCCTTCTACGCGCAGCACAATCCCTACGCGGCCTATTCCAAC
AAGACGCAGGGCAACACGGTCACGATCCAGAGCGCCGTTCCCGTTGGGCAGGTGACGGGCAAGGGTGGCT
CGTACATCGTCGATTTCCTGGTAAAGCACTATGGCCCGCATGGCGGCGTGGATGGCGAGCAGAACTGGCA
AGGCACGGTCACTTACGCGACGGTCCCGCCATCGAACAACCCCAATGTCCTGAAAGGCAATCCATTCGGC
ATCTACATCACGCACTTTGCTTTCAGTCCGCAGGTGTAA
 Primer design