SecReT4
Protein ID: 198283512
T4SS name [ID]Trb [483]
Gene symbol-
Locus tagLferr_1393
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]1349261..1350376 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDB5ERV5
KEGG IDafe:Lferr_1393
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.4e-25, Aligned region: 140..369
Protein Sequence: 371 a.a.     [Download]
>gi|198283512|ref|YP_002219833.1| conjugal transfer protein TrbG/VirB9/CagX [Acidithiobacillus ferrooxidans ATCC 53993]
MKTKTLLSLGLAVLPGLALAGVDTGLPAVNPISSLQGKPPIQPAGTKTGSAHPSTTPSASGGTTSAGQKV
PAISPEAAARMATAHVWQQSIATPPEGPESAATRALARQSLTASQAMDDTLPVIGGANGTVDSLAGRPVL
VCSPLHTCIIELPEGVKPVTTVGVSKSEWNVQQALVGKQPEIFLSPKFQGLHQNIVVAATDQGRPINYEI
RLVSDAVRYIPALKIEDSGGEVRSWKTDLQSADSRTADNAPTDQSAADHKGNVLPLPNIRLNHVNLRWSI
HCGGGGWFRSSDCKPIRPLRVYDDGTHTFIDMPQGLASHGGFPILQARNASGHLIGVDTQIRGNTYVVDS
VPAEILLRLGSEVVTIHQEGK
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|198282148|ref|NC_011206.1|:1349261-1350376 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGAAAACCAAGACATTGCTTTCTTTGGGGCTTGCCGTCCTTCCTGGATTGGCGCTGGCAGGCGTGGATA
CTGGACTCCCTGCGGTGAACCCGATCAGTTCGCTGCAGGGAAAACCACCAATACAGCCTGCAGGGACGAA
AACCGGTTCCGCCCATCCGTCCACGACACCATCCGCATCTGGCGGCACCACGTCTGCGGGCCAGAAAGTC
CCGGCCATCTCCCCGGAGGCTGCCGCGCGGATGGCAACGGCGCATGTGTGGCAACAGTCCATCGCCACCC
CGCCCGAAGGCCCAGAAAGTGCTGCAACCAGAGCGTTGGCACGTCAGTCGCTGACGGCGTCCCAGGCGAT
GGACGACACCCTTCCGGTGATCGGCGGCGCGAACGGAACCGTCGACAGCTTGGCCGGTCGGCCCGTGCTG
GTTTGCTCGCCGCTGCACACCTGCATCATCGAGCTGCCCGAGGGCGTCAAGCCCGTGACGACCGTCGGCG
TCAGCAAGTCGGAATGGAATGTGCAGCAGGCGCTGGTGGGGAAACAGCCGGAAATCTTCCTGAGCCCGAA
ATTCCAGGGTCTCCACCAAAACATCGTGGTAGCCGCAACCGACCAGGGCAGGCCCATCAACTATGAAATC
CGTCTGGTCAGTGACGCGGTACGCTACATTCCCGCCCTGAAGATCGAGGATAGCGGGGGCGAGGTCCGTT
CCTGGAAAACAGACTTGCAGTCAGCAGACTCGCGGACGGCAGACAACGCACCAACGGATCAGTCGGCTGC
CGACCATAAAGGCAATGTACTGCCTCTGCCCAATATCCGTCTCAACCACGTCAATCTTCGCTGGTCCATT
CATTGCGGTGGCGGCGGATGGTTCCGTTCCAGCGACTGCAAACCGATCCGTCCATTGCGCGTGTATGACG
ATGGGACCCATACCTTCATCGACATGCCCCAGGGGCTGGCGAGCCATGGGGGCTTTCCCATCCTGCAAGC
CCGCAATGCCAGCGGACACCTGATCGGAGTCGATACCCAGATCCGGGGCAACACCTATGTCGTCGATTCA
GTTCCTGCCGAGATCCTGTTACGGCTGGGTTCTGAGGTGGTCACCATCCATCAGGAGGGGAAGTAA
 Primer design