SecReT4
Protein ID: 198283514
T4SS name [ID]Trb [483]
Gene symbol-
Locus tagLferr_1395
StrainAcidithiobacillus ferrooxidans ATCC 53993
Repliconchromosome [GenBank: NC_011206] [Browse all T4SS(s) in this replicon]
Location [Strand]1351397..1352857 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB5ERV7
KEGG IDafe:Lferr_1395
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.8e-54, Aligned region: 253..441
Protein Sequence: 486 a.a.     [Download]
>gi|198283514|ref|YP_002219835.1| conjugation TrbI family protein [Acidithiobacillus ferrooxidans ATCC 53993]
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEVKPDRDRMATR
IKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGAPVAPAHRKQVHKPTVPGGAS
DTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFASALGTGSAGSGAGEGLAWKTPESTPSAQTPT
VLPTALPGASLPGASLPDAEPSAAKKTKKKTPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAV
VSQNVYSSVNGATLLIPAGAKLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAG
EVNDHTWLIFKNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIA
PTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKGLHPAKG
 
Nucleotide Sequence: 1461 bp     [Download]
>gi|198282148|ref|NC_011206.1|:1351397-1352857 Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome
ATGAAAAGCGGCAAAGACTTTTTCTCCGATTTGCTCCAGAAAAAGAAAGGGCTGCTCCCGGCAGGGCAAC
AGCCCGCCGGGGATAGCCGCAAAGGCCCTGGCGGGCAGCAAGACCCTTGCGGGCAGCCAGGCCCTAGCAG
GCCGCAAGGCCCACAAGTCAGTCAGCCCGGGATCGAGGTCAAGCCGGACAGGGACCGGATGGCGACGCGC
ATCAAGCGGACGCCGCTCTATATTGCGGCTGCGGTGGTCGGACTGGGCGCCTATGGCGGCTATGAGTATC
TGCAAAGTCACCCGATGTTCGGGAACGCCAAGCCGCAGGTGCAGGCCAAAACTATCCAGCCGGCGAGCGG
GACTGGCGCACCGGTCGCCCCTGCGCACCGGAAGCAGGTCCACAAGCCCACCGTGCCTGGAGGGGCGTCG
GACACGTCGGCAACCGCGGCCACGAACAGTGATGCTGACCAGTCTCATCCAGCGAAGGCTCCAGCGTCCA
CAGTGCCCAAAAAGAATCCCTACGCAACGCAGGACGCCGCCTTCGCGTCCGCCCTGGGTACGGGAAGCGC
CGGGAGCGGGGCCGGTGAGGGCCTTGCCTGGAAAACGCCGGAGTCAACGCCATCCGCACAGACTCCGACA
GTTCTCCCTACGGCCCTGCCGGGTGCATCCCTGCCGGGAGCATCCCTGCCGGACGCGGAACCGTCGGCAG
CGAAGAAAACAAAGAAGAAGACCCCGCCGTCCCTGGTGACCCGGGAGACGAGCCCCTACGAGATTCTTTC
CGGGTCGGTCATTCCCGCCGTTTTGCAGACGGGCATCAAGAGCTATCTGCCGGGAGAGATCACGGCGGTG
GTCAGCCAGAACGTCTATTCGTCCGTGAACGGGGCAACGCTCCTGATCCCTGCCGGCGCCAAATTGGTGG
GCACCTATGACACACAGACGGCCCTGGGCATCAACCGGCTGGCCGTTGCCTGGACGCGCATCGAGTTTCC
GAACGGCACCACCATGAACCTGCCGGGATACGAAGGGGCAGGTGGTGCTGGATACGCCGGCTTCGCCGGG
GAGGTCAATGACCACACCTGGCTGATCTTCAAGAATGCGTTATTGATGTCGATCGTGGATGCCGGGATGG
CGATTGCTTCTCCGTCCACATCGACCAGTGTGACAGGCCAGATGTCCGGGAATGTGGCGCTTCAGGACAG
CGAGCAAGCCCTGGCACAGACCTTTGGGGAAGCCGAATCCCAGCTGCTGGAAAAGTACATCGACATCGCA
CCCACGATCACCATTCCCACCGGCTATCTGTTCTCGGTGGTGGTGGCGCATGACATGGTCTTCCCCGGCC
CCTACGACCCGGCCATGCAGACGGGATCGGCCATGGTCGACCAGGCGCTTGGGCCGAATCTCAATCCCTA
TGGGTTACGCCCTGCCAAGGGGCTGCGCCCTGCCAAGGGGTTGCACCCTGCGAAGGGGTAA
 Primer design