SecReT4
Protein ID: 206479945
T4SS name [ID]Tra_F [527]
Gene symboltraG
Locus tagpBCA020
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]26157..29195 [-]
Productputative TraG conjugative transfer protein
Component typeTraG_F
UniProt IDB4EQN2
KEGG IDbcj:pBCA020
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 7.2e-98, Aligned region: 4..464
Protein Sequence: 1012 a.a.     [Download]
>gi|206479945|ref|YP_002235456.1| putative TraG conjugative transfer protein [Burkholderia cenocepacia J2315]
MNIEIQTYWNVETLYYVLNAVASVMTSGGWPGLIKFVFLVALLIAMFAYMGRHGDMAMWFIQAFAFVTIL
NMPIARVMLSDRTDLQPPRQVDHVPVALAAIAQASSLSFGFLTRAYETAFNVPDDLGLAKGDVGFGHRIL
RQVNSAVVRDPALRADLMQFFKECTKYDILDGAIAPSQIVGATDTWNTIFSNTSPARFVTYNVLTAQPVT
DTCQNVALLLKPRVDAAVADAQAFYGRKAFPQVSSDGIAQQMFLSTVSTSYSWLLDASQSASDAMKQAMF
NNIWRDAGPGIARAHDDPAAIADTNALIAEAEAARQANGSNSALSLLGQETIPHMRNWIEAITYALFPVM
VLLMIVVPQEKAKYVLGGYFMILVWIGLWPLLFAIINHLSLMWLHYKLTALHLSAGVPFQLSSAFDSTLV
DEQAMIGYMVVLVPFIAGAIVKMGDGAIFGLADRALSGFATAGSRAGAAIASGNYSMGQAGLDTASVNTT
TMQKFDGNMLMNSGMKTVQLSDGSTMSVSSNGRAAYQKFANHLLTSMQLEDAQNSGHSFDRFSGTTSTSG
WSSSTRSGSSVGSSESFGHASERGATQSIGSETATTMSGGTSGRAMHDESVGQTNQIGTRFGTGIGATDS
IQLHAGGSGHLGIDASQGGATPRAPGAGASDRDARRVANAMKQGGASAEQIDSAMQNMRGNQAAAEGAPS
VRRGGGASLSLGAQVTGIRNYTAGHDRDWSSQSDHRTGDSVSSGSEVSQTGSSSTRNATGTQSSQSDRHD
SSATRSSFSESAFQREHGVHSEAGSRSTSSDGNSMRFAIERNLAEDPDFMMKVGQRNHVSATRMWQMSED
KVIGMAAEYLDWKAMAQNMRGPQGAGANDDAVAPKLAHDFGSSSRGRAGAGHTSAGAGDFGGRVKATGFS
STDPVKPNMTSPTEISAAQHALDQGRGIGQRAKDFDADVHKHASPDRALGEGRVTQTEVNAANEDRDLAD
TVRRSWNAPRRALGMKEYDDYDTKDVPPEIKK
 
Nucleotide Sequence: 3039 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c29195-26157 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGAACATCGAGATCCAGACCTACTGGAACGTCGAAACGCTCTACTACGTGCTCAACGCCGTCGCATCGG
TGATGACGAGCGGCGGGTGGCCCGGCTTGATCAAGTTCGTCTTCCTCGTTGCGTTGCTCATCGCGATGTT
CGCGTACATGGGGCGCCACGGCGACATGGCGATGTGGTTCATTCAGGCGTTCGCGTTTGTCACGATTCTC
AATATGCCGATCGCGCGAGTGATGCTTTCCGATCGCACGGACCTCCAGCCCCCTCGGCAGGTCGATCATG
TGCCGGTGGCGCTTGCCGCAATCGCGCAGGCAAGCTCGCTTTCGTTCGGGTTCCTGACGCGCGCGTACGA
AACCGCGTTCAATGTTCCGGATGATCTCGGTCTCGCGAAGGGTGACGTAGGCTTTGGTCACCGAATTCTG
CGGCAGGTGAATTCCGCAGTGGTACGCGATCCTGCGCTCCGCGCCGACCTGATGCAGTTCTTCAAGGAGT
GTACGAAGTACGACATCCTGGACGGGGCGATCGCGCCCAGCCAGATCGTCGGTGCGACGGACACGTGGAA
CACGATCTTCAGCAATACCAGCCCTGCCCGCTTCGTTACATACAACGTGCTGACGGCTCAACCCGTCACG
GATACGTGCCAGAACGTGGCGCTGCTTCTCAAGCCACGAGTGGACGCTGCCGTCGCGGACGCACAAGCAT
TTTATGGCCGCAAGGCGTTTCCGCAGGTGAGCTCGGACGGGATCGCTCAGCAGATGTTCCTCTCGACCGT
CTCGACGTCCTACTCGTGGCTCCTCGACGCATCGCAGTCAGCCTCGGATGCCATGAAGCAGGCGATGTTC
AACAACATCTGGCGGGACGCGGGTCCCGGCATCGCGCGCGCGCACGACGACCCGGCGGCGATCGCCGACA
CAAACGCTCTTATCGCGGAGGCAGAAGCGGCGCGCCAGGCGAACGGGTCGAATAGCGCCCTAAGCCTGCT
CGGCCAAGAAACGATCCCGCACATGCGCAACTGGATCGAAGCGATCACCTACGCCCTGTTCCCTGTCATG
GTCTTGCTGATGATCGTGGTACCGCAGGAGAAGGCGAAGTACGTCCTCGGCGGCTATTTCATGATCCTCG
TGTGGATCGGGTTGTGGCCGCTGCTGTTCGCAATCATCAACCACCTGTCACTAATGTGGCTGCACTACAA
GCTGACGGCGCTGCACCTGTCGGCCGGCGTGCCGTTCCAGCTCTCCTCGGCGTTCGATTCGACTCTGGTC
GACGAGCAGGCGATGATCGGATACATGGTGGTGCTCGTGCCGTTCATCGCGGGCGCAATCGTCAAGATGG
GCGACGGCGCGATCTTCGGCCTGGCCGATCGAGCTTTGAGTGGCTTCGCCACCGCCGGTTCGCGGGCCGG
CGCCGCAATTGCGTCCGGCAACTACAGCATGGGACAGGCCGGCCTTGACACCGCATCGGTCAACACTACG
ACGATGCAGAAGTTCGACGGCAACATGCTGATGAATTCCGGCATGAAGACGGTCCAGCTTTCGGACGGTT
CCACGATGTCGGTATCCAGCAACGGCCGCGCTGCGTATCAGAAGTTCGCGAACCACCTTCTGACGTCGAT
GCAGCTCGAAGATGCCCAGAACTCTGGTCACAGTTTCGACCGGTTTAGCGGTACAACATCGACGTCGGGC
TGGAGCAGTTCGACGCGTTCGGGAAGTTCGGTCGGCAGCAGCGAGAGTTTCGGGCACGCGTCCGAGCGCG
GTGCGACTCAGAGCATCGGGTCGGAAACTGCGACGACGATGTCCGGCGGTACCAGCGGCCGCGCAATGCA
CGACGAGAGCGTCGGACAAACCAATCAGATCGGGACACGGTTTGGTACGGGCATCGGTGCCACCGACAGT
ATTCAACTTCACGCCGGCGGGAGTGGTCACCTTGGAATCGATGCTTCCCAGGGCGGCGCCACTCCGCGCG
CACCGGGCGCCGGCGCTAGTGACCGCGACGCGCGTCGGGTTGCCAACGCTATGAAGCAAGGGGGCGCGTC
GGCAGAGCAAATCGATTCCGCGATGCAGAACATGCGCGGCAACCAAGCGGCGGCGGAAGGCGCACCTTCT
GTCCGGCGCGGCGGTGGCGCTTCGCTGAGCCTTGGGGCGCAAGTAACCGGTATTCGAAACTACACGGCCG
GCCACGATCGCGACTGGTCGTCGCAATCGGACCATCGCACTGGTGATTCGGTATCGTCGGGCAGCGAAGT
TAGCCAAACGGGTTCGTCCAGCACACGTAACGCAACTGGTACCCAATCGTCGCAATCGGATCGCCATGAT
TCGTCGGCAACTCGGTCTAGCTTTTCGGAAAGCGCGTTCCAGCGCGAGCATGGCGTGCACAGCGAGGCTG
GCTCGCGTTCCACTTCGTCAGACGGCAATTCGATGCGCTTCGCGATCGAGCGAAATCTGGCGGAAGATCC
CGACTTCATGATGAAGGTCGGCCAGCGCAACCACGTTTCGGCGACGCGCATGTGGCAGATGTCCGAGGAC
AAGGTAATCGGCATGGCCGCCGAGTATCTGGACTGGAAAGCGATGGCGCAGAACATGCGCGGCCCACAAG
GAGCCGGAGCCAATGACGATGCCGTCGCCCCCAAGTTGGCCCACGACTTTGGATCGTCGTCGCGTGGTCG
AGCTGGTGCCGGCCACACCTCCGCTGGCGCCGGCGATTTCGGAGGCCGGGTCAAGGCAACGGGCTTCTCC
TCGACCGATCCGGTCAAGCCGAACATGACGTCGCCGACCGAAATCTCGGCAGCACAGCACGCGCTTGATC
AAGGTCGCGGCATCGGCCAACGCGCGAAGGATTTTGACGCGGACGTGCACAAGCACGCGAGCCCGGACCG
GGCGCTTGGCGAGGGGCGCGTGACCCAGACCGAGGTGAATGCGGCGAACGAGGATCGGGATCTTGCCGAT
ACCGTCCGCCGGTCATGGAATGCCCCGCGCCGGGCGCTCGGGATGAAGGAATACGACGACTACGACACGA
AGGATGTCCCGCCGGAGATCAAGAAATGA
 Primer design