SecReT4
Protein ID: 206479946
T4SS name [ID]Tra_F [527]
Gene symboltraH
Locus tagpBCA021
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]29205..30659 [-]
Productputative TraH conjugative transfer protein
Component typeTraH_F
UniProt IDB4EQN3
KEGG IDbcj:pBCA021
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.6e-103, Aligned region: 40..399
Protein Sequence: 484 a.a.     [Download]
>gi|206479946|ref|YP_002235457.1| putative TraH conjugative transfer protein [Burkholderia cenocepacia J2315]
MPKLLASPLFRRYLRGLQVLLASVSIACLAYTQPAAAMSMQQLFDTVNAQGNYTSPAALQGQTLNMYSGG
SLFMRMPKRTYQLSSVTPPSWNAGCGGIDLFMGGFSFINKEQFVAMLRNIGSNALGYGFKLAIQNLCPTC
DNVMQALQATAQQINRLNMDSCETAKGLVNAALPDTWTRGRQDAAKNFGVDSNIFENVTDAWTNVMNDEN
KADDVIDQVKQSNPAAKDVLPTGNVVWKALKKIDGMTDEERMVLMSLVGSMIFPTQGNAQAPKPLMPTDI
DVATLIGNGVDGDTINVPIWRCDTTTDDGCLNPYSDQLSTRSFRSMVMTKMNNMVDHIAARSPHDDVSQV
IAFLNTTDLPIYAMLAAGTRYNNTQIADSTMGVYIDLIAAKYAETYIRRCTKDLQDAIGKYAALADSSQT
QALSDLKPQLERIRNTAHEALMQAYTRTVSTHSLTTELAAMQRAVDSNLSETLRSSLAFGKSLN
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c30659-29205 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGCCTAAGCTTCTCGCTTCCCCCCTGTTTCGGCGGTATCTGCGCGGCCTGCAGGTCCTGTTGGCGAGCG
TGTCGATCGCATGTCTCGCATACACCCAACCGGCGGCCGCAATGTCGATGCAGCAGCTGTTCGACACGGT
GAACGCCCAAGGGAACTACACCAGTCCGGCGGCGTTGCAAGGCCAAACGCTCAACATGTACTCGGGCGGT
TCGCTGTTTATGCGTATGCCCAAGCGCACGTATCAATTGAGTTCCGTGACACCTCCGTCATGGAATGCCG
GGTGTGGCGGAATCGACCTGTTCATGGGCGGATTCTCGTTTATCAACAAGGAGCAGTTCGTCGCGATGCT
GCGCAACATTGGCTCCAATGCGCTCGGTTACGGCTTCAAGCTTGCGATTCAAAACCTGTGTCCTACGTGC
GACAACGTCATGCAGGCTCTGCAGGCGACCGCGCAGCAGATCAATCGACTGAACATGGATTCGTGCGAGA
CCGCGAAGGGATTGGTCAACGCGGCACTCCCTGACACGTGGACGCGCGGCCGGCAGGATGCCGCCAAGAA
CTTCGGCGTCGACTCGAACATCTTCGAGAACGTTACTGACGCGTGGACGAACGTCATGAATGACGAGAAC
AAGGCTGACGACGTCATCGACCAGGTGAAGCAGAGCAATCCGGCGGCGAAGGACGTGTTGCCGACGGGCA
ACGTGGTGTGGAAGGCGCTGAAGAAGATCGACGGGATGACGGACGAAGAACGCATGGTGTTGATGTCGTT
GGTCGGCAGCATGATTTTCCCGACGCAAGGTAACGCGCAGGCGCCCAAGCCCCTGATGCCGACAGACATC
GACGTAGCGACGTTGATTGGCAATGGTGTAGACGGCGACACGATCAACGTGCCGATCTGGCGTTGTGACA
CCACCACCGACGATGGCTGCTTAAATCCCTACAGCGATCAATTGTCGACCCGCAGCTTCCGATCAATGGT
GATGACGAAAATGAACAATATGGTCGACCACATTGCTGCGCGATCGCCGCACGACGACGTGAGCCAGGTG
ATAGCGTTTCTGAACACTACCGACCTTCCGATCTACGCGATGTTGGCGGCCGGCACGCGCTACAACAACA
CGCAGATTGCCGACAGCACGATGGGTGTCTACATCGACCTGATCGCGGCGAAATATGCCGAAACGTACAT
TCGCCGATGCACGAAGGACCTTCAGGACGCGATCGGGAAATATGCAGCGCTCGCTGACTCGTCACAGACG
CAGGCGCTGAGCGACCTGAAACCGCAGCTCGAGCGTATCCGCAATACGGCGCACGAAGCGCTGATGCAGG
CGTACACGCGCACCGTCAGCACGCATTCGCTCACCACGGAATTAGCGGCGATGCAGCGCGCGGTGGACTC
GAACCTGTCGGAGACGTTGCGTTCGTCCCTGGCTTTCGGCAAAAGCTTGAACTAA
 Primer design