SecReT4
Protein ID: 206479950
T4SS name [ID]Tra_F [527]
Gene symboltraF
Locus tagpBCA025
StrainBurkholderia cenocepacia J2315
Repliconplasmid pBCJ2315 [GenBank: NC_011003] [Browse all T4SS(s) in this replicon]
Location [Strand]32664..33497 [-]
Productputative TraF conjugative transfer protein
Component typeTraF_F
UniProt IDB4EQG1
KEGG IDbcj:pBCA025
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.8e-68, Aligned region: 47..266
Thioredoxin_2 [PF13098], Evalue: 7.5e-06, Aligned region: 173..262
AhpC-TSA [PF00578], Evalue: 2.5e-05, Aligned region: 152..211
Thioredoxin_3 [PF13192], Evalue: 3.8e-05, Aligned region: 179..241
Redoxin [PF08534], Evalue: 5.6e-05, Aligned region: 156..247
Protein Sequence: 277 a.a.     [Download]
>gi|206479950|ref|YP_002235461.1| putative TraF conjugative transfer protein [Burkholderia cenocepacia J2315]
MRPTLPILLSSAIALSGVAHAADNPLDYPSIWNCRAGDVSPYAPRTNWYCDDVDQAPPTAAAPPAAPAPN
AEPQRIEIPDIRTAEQMRKELARRLDLATMEPTDDHIRDYLQLWQVTQQKGSTFADTWRRVVWQNPALDY
TLTRPANNSAIKVFDAQRDQDQEAQLRALAKDHGLIFFFRSDCPYCHAMAPAVKMLADKYGIDVLGVSVD
GRGIDEFPHPADGRAQAVAWGVERVPALFIGSKQTGDHAAIGFGAMSVSEIVNRLFVLTGTQPGQTF
 
Nucleotide Sequence: 834 bp     [Download]
>gi|206479926|ref|NC_011003.1|:c33497-32664 Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence
ATGCGCCCTACGCTTCCCATTCTTCTTTCGTCCGCGATCGCCCTGTCCGGCGTCGCCCACGCGGCTGACA
ATCCGCTCGACTACCCGTCGATCTGGAATTGCCGTGCTGGCGATGTGAGCCCATACGCGCCGCGCACCAA
CTGGTACTGCGACGACGTGGACCAAGCGCCGCCCACAGCAGCTGCTCCTCCGGCCGCGCCGGCACCGAAC
GCAGAGCCCCAGCGAATTGAAATTCCAGATATCCGAACGGCAGAGCAGATGCGAAAGGAACTCGCGCGCC
GGCTCGACCTCGCGACGATGGAGCCAACCGACGACCACATCCGCGACTACCTGCAGCTTTGGCAGGTGAC
CCAGCAGAAGGGCTCGACCTTTGCTGATACGTGGCGTCGCGTCGTCTGGCAGAACCCTGCGCTCGACTAC
ACGTTGACCCGGCCCGCAAACAATTCGGCGATCAAGGTGTTCGACGCGCAGCGCGACCAGGATCAGGAAG
CGCAGCTGCGTGCCCTAGCCAAGGACCATGGGCTGATCTTCTTCTTCCGCTCTGACTGCCCTTACTGCCA
CGCGATGGCTCCGGCCGTGAAGATGCTCGCAGACAAATACGGAATCGATGTCTTGGGCGTTTCAGTCGAC
GGCCGCGGCATCGACGAGTTTCCGCATCCGGCCGATGGCCGTGCACAGGCTGTCGCATGGGGCGTCGAGC
GTGTGCCCGCGCTCTTCATTGGCTCGAAGCAGACGGGCGACCACGCCGCGATCGGCTTCGGGGCGATGTC
GGTATCAGAAATCGTCAACCGACTGTTCGTGCTGACCGGGACACAGCCCGGGCAGACCTTCTAA
 Primer design